Clone IP07934 Report

Search the DGRC for IP07934

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:79
Well:34
Vector:pOT2
Associated Gene/TranscriptAndorra-RA
Protein status:IP07934.pep: gold
Preliminary Size:726
Sequenced Size:967

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12611 2005-01-01 Successful iPCR screen
Andorra 2008-04-29 Release 5.5 accounting
Andorra 2008-08-15 Release 5.9 accounting
Andorra 2008-12-18 5.12 accounting

Clone Sequence Records

IP07934.complete Sequence

967 bp (967 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022495

> IP07934.complete
AGTACATAGTATCCAAAATTATTCCCTTCCAGCCCAAGATGAATCGATAT
CATGAACTCAGCATGTCGTGGGAAATGCTGCGCGATCTCTACGAGACCTG
GCTAATCCTGGCCATTGGCATGTTGGTGCGCTGGAATCGCTGGCGTCCGT
TGATCCATGGCATGGTATCGCCACTGGATCCATCGCTTAAGCACATCGTG
GGCGACAATGAACGCTGGGCGGGAGTCTACTTTGGATGCGGCACACTCAT
GACCATCATGCAGTATCGATCACTTTGGGTGCGCCGGTGTCGTCACCGCG
TCCACATCCTGATGCTGCTGTCCGAAATAATGCTACTGCTCCAGCTGGTG
CACTGGATCGACTGCCAGCTGTGGCAATCCTTTCTGAGCCTCTTCGAGGA
GCTCTTCATCGCCCTGGGACGCGGTCAATGGGGCTCCTGGATCTTTTGCT
GTCCGGCCGCAGTGCGCAATCTGTTCCTGCGTGGCGATGTCTTCGATGTG
TTCCGCTTGCTCGCCTCGTTCGCCATCTTCGCCGTGGCCCTAAACTCGAC
AGCTGGTGAATGGCGGGTGTCCTTGGACTTCCTGCTAATCGGCTATTTCC
CAAAAACTTCACTCTGGAGGCAGTCGCTCTATGTGGAATATAGGAGTAAG
GGTTTCGAGCCCACGGGCTCGTACGTACTGCTACCACTTCCCCCACCCGA
GCTCCTCATCTACAAGCGTATGTGTCGCCTGTGTCTGCAGCAACTTGAAA
CGAATCCCACTCACCAAAAGATTCAGATGCCTTGTTAAACGAAGGAGCAG
TGCAGTTCATTCCTGGCTTCTTTATTTACTGTAGCTGATACGTTTAAATT
GAATTAGTTTTCGCATCTTTGGCAAATTCCAATTATACATATATTTTATA
TCTCTGAATATTCATACAATAAAATCTAGCGTGTGATAAGCTCTTAGAAA
AAAAAAAAAAAAAAAAA

IP07934.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Andorra-RA 947 Andorra-RA 1..947 1..947 4735 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18067776..18068719 947..1 4655 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18178523..18179472 950..1 4750 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18186621..18187570 950..1 4750 100 Minus
Blast to na_te.dros performed 2019-03-17 00:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6885 451..307 115 54.1 Minus

IP07934.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:07:51 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18067776..18068719 1..947 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:34:15 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
Andorra-RA 1..750 39..788 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:19:50 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
Andorra-RA 1..750 39..788 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:57:54 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
Andorra-RA 1..750 39..788 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:03:55 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
Andorra-RA 1..750 39..788 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:12:04 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
Andorra-RA 1..750 39..788 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:20:09 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
Andorra-RA 1..947 1..947 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:19:50 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
Andorra-RA 1..947 1..947 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:57:54 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
Andorra-RA 1..947 1..947 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:03:56 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
Andorra-RA 1..947 1..947 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:12:04 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
Andorra-RA 1..947 1..947 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:07:51 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
X 18178526..18179472 1..947 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:07:51 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
X 18178526..18179472 1..947 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:07:51 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
X 18178526..18179472 1..947 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:57:54 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18072559..18073505 1..947 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:40:03 Download gff for IP07934.complete
Subject Subject Range Query Range Percent Splice Strand
X 18186624..18187570 1..947 100   Minus

IP07934.hyp Sequence

Translation from 2 to 787

> IP07934.hyp
YIVSKIIPFQPKMNRYHELSMSWEMLRDLYETWLILAIGMLVRWNRWRPL
IHGMVSPLDPSLKHIVGDNERWAGVYFGCGTLMTIMQYRSLWVRRCRHRV
HILMLLSEIMLLLQLVHWIDCQLWQSFLSLFEELFIALGRGQWGSWIFCC
PAAVRNLFLRGDVFDVFRLLASFAIFAVALNSTAGEWRVSLDFLLIGYFP
KTSLWRQSLYVEYRSKGFEPTGSYVLLPLPPPELLIYKRMCRLCLQQLET
NPTHQKIQMPC*

IP07934.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Andorra-PA 249 CG12611-PA 1..249 13..261 1357 100 Plus

IP07934.pep Sequence

Translation from 38 to 787

> IP07934.pep
MNRYHELSMSWEMLRDLYETWLILAIGMLVRWNRWRPLIHGMVSPLDPSL
KHIVGDNERWAGVYFGCGTLMTIMQYRSLWVRRCRHRVHILMLLSEIMLL
LQLVHWIDCQLWQSFLSLFEELFIALGRGQWGSWIFCCPAAVRNLFLRGD
VFDVFRLLASFAIFAVALNSTAGEWRVSLDFLLIGYFPKTSLWRQSLYVE
YRSKGFEPTGSYVLLPLPPPELLIYKRMCRLCLQQLETNPTHQKIQMPC*

IP07934.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22523-PA 247 GF22523-PA 12..247 12..237 317 31.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18140-PA 263 GG18140-PA 1..244 1..246 825 68.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17795-PA 212 GH17795-PA 15..193 12..191 234 31.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Andorra-PA 249 CG12611-PA 1..249 1..249 1357 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:36:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15134-PA 212 GI15134-PA 15..191 12..189 181 33.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:36:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22832-PA 248 GM22832-PA 1..248 1..249 1081 86.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:36:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24668-PA 177 GD24668-PA 1..175 71..246 697 83 Plus
Dsim\GD24667-PA 128 GD24667-PA 79..120 1..42 191 83.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18996-PA 212 GJ18996-PA 15..207 12..205 202 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19875-PA 231 GK19875-PA 7..191 12..191 246 28.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:36:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15550-PA 243 GE15550-PA 1..236 9..242 820 71.7 Plus