Clone IP07978 Report

Search the DGRC for IP07978

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:79
Well:78
Vector:pOT2
Associated Gene/TranscriptCG14260-RA
Protein status:IP07978.pep: gold
Preliminary Size:750
Sequenced Size:937

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14260 2005-01-01 Successful iPCR screen
CG14260 2008-04-29 Release 5.5 accounting
CG14260 2008-08-15 Release 5.9 accounting
CG14260 2008-12-18 5.12 accounting

Clone Sequence Records

IP07978.complete Sequence

937 bp (937 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022463

> IP07978.complete
AGCAAAGCCTCCAAAAAATCCCCAGTCACTATGAACTGCAAGCTACGCCG
CCTGGACCTGTTGCGGAATGGCCAAAAGTCGGACTGCGAGCTCCATGTCT
CGCAACCGGACAAGTTGAAGGAGGGCAAGCGTTGTCCATGCATTTTCCGC
TGCCACCAGGTGATGCTCATCTCCGCCTCCGCGGAGTTCGAGCGCCTGAT
CAGGGATCCCGAGTTCCAGAAGAACAAGCGAGTGATCAGCGTGGACGACG
CCTCTCCCACCGCCTACGAGGCGTTGCTCCTCTACATCTACACGTACGAG
GTGTGCAATGCGGTGACCATCGACATGTGCGGTGACCTCATGCTGCTGGC
CGAGCGCTACGAGATGCTGGACTTCATCGACTGCTACATCGACAAGCTGG
CCCACCAGGAGTGGCCCATGGAGGTGGTTCTGCAGGTCTTCCACCTGGCC
AGCGAGCACCACCATCCGGCACTGATGGATCTCGTGGCGAAAAAAATCCT
CCCCGTAGCCACGCAGGTGCTCATGGACAACTCGTTCCTCAAGCTGAGTG
TTAAGGAGCTAAAGGCTCTGATGATAATCCTGAAAAAGGATGGAGATCTC
TCCGATCACGAACTGCTGACCTCGCTGAAGAACTACCAGGATGTGAACAA
CCTGCGCTACGAGGACATGGAGCAGTTCCAGCAGCTCGTTGAGGTAACCC
AGTTGTTCGGTCACGTTCTCTTCGAAGTGGATGGCACCATAGTTGTGCCC
GAAGAAGAAAAACCTTCGCCGGAGGAATAGATAGGTTTGCTTACCACCCA
AGGAAATAGACAGGATGGTGTACATATCTAGAGGGATCATTTATTGGATT
AGGGATCGAAAAACAAACAAAATCGAATTCATATCGGCTTAAAGAATAAA
TACTACCTATAAACATAATAAAAAAAAAAAAAAAAAA

IP07978.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14260-RA 920 CG14260-RA 1..920 1..920 4600 100 Plus
nc_19523.a 941 nc_19523.a 42..533 1..492 2460 100 Plus
nc_19523.a 941 nc_19523.a 534..941 509..916 2040 100 Plus
l(3)mbt-RA 5361 l(3)mbt-RA 5167..5361 920..726 975 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23088389..23088880 1..492 2460 100 Plus
chr3R 27901430 chr3R 23088929..23089354 493..919 2040 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27265457..27265948 1..492 2460 100 Plus
3R 32079331 3R 27265997..27266424 493..920 2140 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27006288..27006779 1..492 2460 100 Plus
3R 31820162 3R 27006828..27007255 493..920 2140 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:13:59 has no hits.

IP07978.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:15:06 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23088389..23088880 1..492 100 -> Plus
chr3R 23088929..23089354 493..919 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:34:31 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
CG14260-RA 1..750 31..780 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:17 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
CG14260-RA 1..750 31..780 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:26:03 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
CG14260-RA 1..750 31..780 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:45 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
CG14260-RA 1..750 31..780 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:18:33 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
CG14260-RA 1..750 31..780 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:20 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
CG14260-RA 1..919 1..919 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:17 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
CG14260-RA 1..919 1..919 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:26:03 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
CG14260-RA 1..919 1..919 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:46 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
CG14260-RA 1..919 1..919 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:18:33 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
CG14260-RA 1..919 1..919 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:06 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27265457..27265948 1..492 100 -> Plus
3R 27265997..27266423 493..919 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:06 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27265457..27265948 1..492 100 -> Plus
3R 27265997..27266423 493..919 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:06 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27265457..27265948 1..492 100 -> Plus
3R 27265997..27266423 493..919 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:26:03 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23091179..23091670 1..492 100 -> Plus
arm_3R 23091719..23092145 493..919 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:16 Download gff for IP07978.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27006288..27006779 1..492 100 -> Plus
3R 27006828..27007254 493..919 100   Plus

IP07978.hyp Sequence

Translation from 0 to 779

> IP07978.hyp
SKASKKSPVTMNCKLRRLDLLRNGQKSDCELHVSQPDKLKEGKRCPCIFR
CHQVMLISASAEFERLIRDPEFQKNKRVISVDDASPTAYEALLLYIYTYE
VCNAVTIDMCGDLMLLAERYEMLDFIDCYIDKLAHQEWPMEVVLQVFHLA
SEHHHPALMDLVAKKILPVATQVLMDNSFLKLSVKELKALMIILKKDGDL
SDHELLTSLKNYQDVNNLRYEDMEQFQQLVEVTQLFGHVLFEVDGTIVVP
EEEKPSPEE*

IP07978.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14260-PA 249 CG14260-PA 1..249 11..259 1296 100 Plus
CG14260-PB 166 CG14260-PB 1..154 11..164 821 100 Plus
CG14262-PA 312 CG14262-PA 76..309 16..247 262 29.6 Plus

IP07978.pep Sequence

Translation from 0 to 779

> IP07978.pep
SKASKKSPVTMNCKLRRLDLLRNGQKSDCELHVSQPDKLKEGKRCPCIFR
CHQVMLISASAEFERLIRDPEFQKNKRVISVDDASPTAYEALLLYIYTYE
VCNAVTIDMCGDLMLLAERYEMLDFIDCYIDKLAHQEWPMEVVLQVFHLA
SEHHHPALMDLVAKKILPVATQVLMDNSFLKLSVKELKALMIILKKDGDL
SDHELLTSLKNYQDVNNLRYEDMEQFQQLVEVTQLFGHVLFEVDGTIVVP
EEEKPSPEE*

IP07978.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16280-PA 260 GF16280-PA 1..248 11..259 942 69.7 Plus
Dana\GF18717-PA 323 GF18717-PA 72..320 1..247 262 26.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11540-PA 249 GG11540-PA 1..249 11..259 1192 90.4 Plus
Dere\GG12123-PA 319 GG12123-PA 81..316 14..247 277 27.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19505-PA 312 GH19505-PA 1..250 11..259 721 55.8 Plus
Dgri\GH21482-PA 274 GH21482-PA 24..269 5..247 296 29.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14260-PA 249 CG14260-PA 1..249 11..259 1296 100 Plus
CG14260-PB 166 CG14260-PB 1..154 11..164 821 100 Plus
CG14262-PA 312 CG14262-PA 76..309 16..247 262 29.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22256-PA 265 GI22256-PA 1..221 11..233 620 54.5 Plus
Dmoj\GI10513-PA 298 GI10513-PA 46..295 3..248 281 27.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24485-PA 400 GL24485-PA 1..236 11..249 806 62.3 Plus
Dper\GL23048-PA 297 GL23048-PA 59..296 14..248 272 26.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12865-PA 389 GA12865-PA 1..236 11..249 807 62.3 Plus
Dpse\GA12866-PA 297 GA12866-PA 59..296 14..248 272 26.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10382-PA 249 GM10382-PA 1..249 11..259 1290 97.6 Plus
Dsec\GM10115-PA 318 GM10115-PA 82..315 16..247 270 29.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15079-PA 235 GD15079-PA 82..219 16..154 179 30.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24047-PA 340 GJ24047-PA 1..247 11..258 751 58.6 Plus
Dvir\GJ23194-PA 312 GJ23194-PA 74..309 13..247 289 28.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22575-PA 258 GK22575-PA 1..239 11..249 784 61.6 Plus
Dwil\GK22591-PA 276 GK22591-PA 38..274 14..248 289 28.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23727-PA 249 GE23727-PA 1..249 11..259 1234 92.8 Plus
Dyak\GE10571-PA 317 GE10571-PA 72..314 7..247 263 27 Plus