Clone IP08001 Report

Search the DGRC for IP08001

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:1
Vector:pOT2
Associated Gene/TranscriptCG14826-RB
Protein status:IP08001.pep: wuzgold
Preliminary Size:660
Sequenced Size:1169

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14826 2005-01-01 Successful iPCR screen
CG14826 2008-04-29 Release 5.5 accounting
CG14826 2008-08-15 Release 5.9 accounting
CG14826 2008-12-18 5.12 accounting

Clone Sequence Records

IP08001.complete Sequence

1169 bp (1169 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022447

> IP08001.complete
ATTCTATTCAATTTATTAAATATGTTTTTACTTTTAAATCAAAAAAATAA
TTTGTAAATCATATACTTGTTAGTATACTTTGAATATTTATGCATACATG
CACCTTTTTGGGTCAGTGTAATCCAGTTCTTGACAAATTCATAATGCTAA
TTGCCTGGCCAAATGTTTGTGCCTCCGAAATTTCCACTTGTCATCTTGCG
TTGATGGCTCACTTCAGAACGAGTTAAGTCCGTGACGCCTACACCTGCAG
CTAGTTAGTAGTCGTTGGGAGCATGAAGTGGACAACGGGTCTGCTCTTGG
CGGTGGCCATGCTCAGCCTGCCATCTCGGGGAGATTCATCCCGAAATCTC
ACGGAATTCATGGGACATCGACAGAAGCGCTGGCTGATCTACCAGAATAG
TGGGTCTTTGAAGTTTAGTATTGGTCCCTCGATGCCCATACCCTTGGGGG
ACAAGGTGACCTTCCGTTCCTGTGTGCTCTCCTACACGCTCCAAGGTGGT
TCCTATTCCCTGCCCACATCACCCATCTGGCCGTGGGATAAGTGGGAAGG
CACCTTCGCTCGTTCCTTGATGCAAATGCGAAGGAATATTGAGCGCCATG
TGGCCAATGGCGGAGTGCGATATGCGGACGATGCCAGGCTCTTGGTCTAC
ACTGCACTGGAGGAGTATATGGGCAGGAGGAACAATGACCGCTCCATGGG
CAGACAATGTCTGCTGCGCTCCATATGCGAGAATGCTCAGATCCATCATC
ATATCGGTGTGTTCTCGGAAATTATGGATATTGTACTCAGGTAAAAGAAA
AGAGTCTTCAAGTTTAAGGAATACGATAAATATTAAGTGCTCCCTCATCA
TTTCTCATTCATTTTCAAACACTTACACGAATCCCCATAAATGCTACTTT
AATCTGCCAATCATTTTAGTCCCGGCAAAGCGGATCTGGACAATGACTAC
CATGATGCCTACGCCGCGGGAAGAGCTGGAGCCAATTGCTTGGGCCTGTA
CAGTGCCTGTCCTCGGGGACACAACTTCCTCGACGGGCTTTTGATTGTGG
AAGATGATTGATTTACTGCTGCTCCTGCTACAGCTACTGCTGCGGATTGC
TGTCGAGTACGGAAGAGAATGGGGATCCGCAATAAAGTTTTCAACCAAAT
CAAAAAAAAAAAAAAAAAA

IP08001.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG14826-RB 1154 CG14826-RB 1..1154 1..1154 5770 100 Plus
CG14826-RA 1325 CG14826-RA 1..790 1..790 3950 100 Plus
CG14826-RA 1325 CG14826-RA 789..1025 918..1154 1185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7226672..7227822 1..1151 5635 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7234512..7235665 1..1154 5770 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7227612..7228765 1..1154 5770 100 Plus
Blast to na_te.dros performed 2019-03-15 18:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 847..886 1064..1103 110 75 Plus

IP08001.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:09:20 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7226672..7227822 1..1151 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:34:37 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
CG14826-RB 1..522 273..794 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:19:25 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
CG14826-RB 1..522 273..794 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:53:41 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
CG14826-RA 1..518 273..790 100 == Plus
CG14826-RA 519..660 920..1061 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:03:34 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
CG14826-RB 1..522 273..794 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:28 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
CG14826-RA 1..518 273..790 100 == Plus
CG14826-RA 519..660 920..1061 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:19:39 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
CG14826-RB 1..1151 1..1151 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:19:25 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
CG14826-RB 1..1151 1..1151 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:53:41 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
CG14826-RA 1..790 1..790 100 == Plus
CG14826-RA 791..1022 920..1151 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:03:34 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
CG14826-RB 1..1151 1..1151 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:28 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
CG14826-RA 1..790 1..790 100 == Plus
CG14826-RA 791..1022 920..1151 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:20 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7234512..7235662 1..1151 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:20 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7234512..7235662 1..1151 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:20 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7234512..7235662 1..1151 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:53:41 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7227612..7228762 1..1151 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:38 Download gff for IP08001.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7227612..7228762 1..1151 100   Plus

IP08001.hyp Sequence

Translation from 272 to 793

> IP08001.hyp
MKWTTGLLLAVAMLSLPSRGDSSRNLTEFMGHRQKRWLIYQNSGSLKFSI
GPSMPIPLGDKVTFRSCVLSYTLQGGSYSLPTSPIWPWDKWEGTFARSLM
QMRRNIERHVANGGVRYADDARLLVYTALEEYMGRRNNDRSMGRQCLLRS
ICENAQIHHHIGVFSEIMDIVLR*

IP08001.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14826-PC 219 CG14826-PC 1..172 1..172 914 100 Plus
CG14826-PA 219 CG14826-PA 1..172 1..172 914 100 Plus
CG14829-PB 219 CG14829-PB 30..172 24..172 361 44.7 Plus
CG13869-PA 215 CG13869-PA 23..165 25..173 184 31.6 Plus
CG17784-PA 237 CG17784-PA 47..189 21..172 141 32.5 Plus

IP08001.pep Sequence

Translation from 272 to 793

> IP08001.pep
MKWTTGLLLAVAMLSLPSRGDSSRNLTEFMGHRQKRWLIYQNSGSLKFSI
GPSMPIPLGDKVTFRSCVLSYTLQGGSYSLPTSPIWPWDKWEGTFARSLM
QMRRNIERHVANGGVRYADDARLLVYTALEEYMGRRNNDRSMGRQCLLRS
ICENAQIHHHIGVFSEIMDIVLR*

IP08001.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25015-PA 221 GF25015-PA 16..174 14..172 740 82.4 Plus
Dana\GF24785-PA 215 GF24785-PA 22..168 17..172 358 43 Plus
Dana\GF13158-PA 219 GF13158-PA 6..167 2..173 196 31.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14410-PA 219 GG14410-PA 1..172 1..172 793 90.7 Plus
Dere\GG14990-PA 219 GG14990-PA 30..172 24..172 361 44 Plus
Dere\GG20881-PA 253 GG20881-PA 45..203 9..173 192 28.7 Plus
Dere\GG11291-PA 221 GG11291-PA 16..172 7..172 152 30.4 Plus
Dere\GG12349-PA 237 GG12349-PA 44..189 18..172 140 32.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16569-PA 221 GH16569-PA 1..174 1..172 670 71.8 Plus
Dgri\GH14932-PA 202 GH14932-PA 10..155 21..172 358 43.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14826-PC 219 CG14826-PC 1..172 1..172 914 100 Plus
CG14826-PA 219 CG14826-PA 1..172 1..172 914 100 Plus
CG14829-PB 219 CG14829-PB 30..172 24..172 361 44.7 Plus
CG13869-PA 215 CG13869-PA 23..165 25..173 184 31.6 Plus
CG17784-PA 237 CG17784-PA 47..189 21..172 141 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13859-PA 221 GI13859-PA 22..174 20..172 675 77.8 Plus
Dmoj\GI13860-PA 221 GI13860-PA 22..174 20..172 675 77.8 Plus
Dmoj\GI11452-PA 217 GI11452-PA 27..170 23..172 337 41.1 Plus
Dmoj\GI11450-PA 216 GI11450-PA 27..169 23..172 334 40.7 Plus
Dmoj\GI18530-PA 228 GI18530-PA 23..178 25..173 198 30.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24903-PA 216 GL24903-PA 25..169 22..172 374 44.7 Plus
Dper\GL10163-PA 209 GL10163-PA 21..159 23..173 202 31.8 Plus
Dper\GL21862-PA 227 GL21862-PA 52..180 35..172 140 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13277-PA 224 GA13277-PA 9..177 7..172 742 79.3 Plus
Dpse\GA13279-PA 216 GA13279-PA 25..169 22..172 373 44.7 Plus
Dpse\GA12585-PA 209 GA12585-PA 21..159 23..173 199 31.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14825-PA 219 GM14825-PA 1..172 1..172 884 94.8 Plus
Dsec\GM13786-PA 219 GM13786-PA 30..172 24..172 376 44.7 Plus
Dsec\GM19804-PA 225 GM19804-PA 21..175 13..173 197 31.8 Plus
Dsec\GM26597-PA 219 GM26597-PA 15..172 8..172 143 30.8 Plus
Dsec\GM23489-PA 237 GM23489-PA 59..189 33..172 138 33.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13999-PA 148 GD13999-PA 5..101 76..172 524 99 Plus
Dsim\GD13083-PA 219 GD13083-PA 30..172 24..172 386 46 Plus
Dsim\GD25297-PA 217 GD25297-PA 25..167 25..173 192 31.6 Plus
Dsim\GD18295-PA 237 GD18295-PA 59..189 33..172 145 33.6 Plus
Dsim\GD21098-PA 219 GD21098-PA 15..172 8..172 143 30.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11720-PA 246 GJ11720-PA 24..196 1..172 650 69.5 Plus
Dvir\GJ13647-PA 217 GJ13647-PA 27..170 23..172 388 45.7 Plus
Dvir\GJ21396-PA 220 GJ21396-PA 6..170 8..173 232 33.1 Plus
Dvir\GJ23411-PA 239 GJ23411-PA 44..192 11..172 148 31.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13171-PA 221 GK13171-PA 7..174 6..172 689 74.4 Plus
Dwil\GK25529-PA 222 GK25529-PA 31..174 25..172 335 43.7 Plus
Dwil\GK22827-PA 224 GK22827-PA 17..177 7..172 150 28.9 Plus
Dwil\GK15682-PA 137 GK15682-PA 7..97 78..173 134 30.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21599-PA 219 GE21599-PA 1..172 1..172 802 91.3 Plus
Dyak\GE20436-PA 219 GE20436-PA 30..172 24..172 369 44 Plus
Dyak\GE13820-PA 215 GE13820-PA 23..165 25..173 190 31.6 Plus
Dyak\GE10802-PA 237 GE10802-PA 44..189 18..172 140 32.9 Plus