BDGP Sequence Production Resources |
Search the DGRC for IP08031
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 80 |
Well: | 31 |
Vector: | pOT2 |
Associated Gene/Transcript | CG16739-RA |
Protein status: | IP08031.pep: gold |
Preliminary Size: | 685 |
Sequenced Size: | 706 |
Gene | Date | Evidence |
---|---|---|
CG16739 | 2005-01-01 | Successful iPCR screen |
CG16739 | 2008-04-29 | Release 5.5 accounting |
CG16739 | 2008-08-15 | Release 5.9 accounting |
CG16739 | 2008-12-18 | 5.12 accounting |
706 bp (706 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022435
> IP08031.complete CAACATTTAGATGTTTTCTTTGAAAAAATAAAGGCAAAAAAATATCACTA AATTTCGGTTTTAAATTTTGAATCGTGTGAACTTTAGTACAGAAGCCGCC ATGAAGTTCTATCCGAATGCAGATGTCTGGTTCTGTGTGGACAAGACCAG CTGCTTGAACAGCTATCAAAAGTATCCACCCACGCACAGCTGGAAGATTC ACGATCGGACCACCGCGCGGGAAATGTACTATTGGCGCGACATCGAGGGC GTGAAGAAGACGGAGATCAAGCTTAAGGATCTGTACTTCACCAATTGGCC CAAAACCCGCATCCGTCCACAGGCCTGCTTGGGATTGCTCTATGCCACGG GCAACAGATTCATCCGACTGACCAAGGCACCACCAGCGGGCTTCAAGTGT GCACCACTGCCCGTCAATCTGGCCACCGCTCGAATTGTCAAAGTGGAGCT GCGCAAGAAGGCGAAGCGCGAAAAACAGGCAGCTAAAAAGGCTAAAAAGG AAGCGAAGAAGGCCAAGAAGGCGGGCAAAAAGGGCAAAGGAAAGGGCGGT AATGGCGATCTTAAGCCAAAGGTCATTAGGACATACGAAGACGCCGAGAA AGCATAATGATTACACATTATATTCAAATCCCGGTGTATTAAAGTGAATT TCGATAATTTTTAAACGTTTTGAAGGCGTATAAAAAATAAAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cr1a | 4470 | Cr1a DMCR1A 4470bp | 4288..4350 | 573..635 | 108 | 63.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 16229024..16229466 | 1..443 | 100 | -> | Plus |
chr2R | 16229516..16229760 | 444..688 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16739-RA | 1..507 | 101..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16739-RA | 1..507 | 101..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16739-RA | 1..507 | 101..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16739-RA | 1..507 | 101..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16739-RA | 1..507 | 101..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16739-RA | 1..667 | 22..688 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16739-RA | 1..667 | 22..688 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16739-RA | 15..695 | 1..681 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16739-RA | 1..667 | 22..688 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16739-RA | 15..695 | 1..681 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20342512..20342756 | 444..688 | 100 | Plus | |
2R | 20342007..20342449 | 1..443 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20342512..20342756 | 444..688 | 100 | Plus | |
2R | 20342007..20342449 | 1..443 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20342512..20342756 | 444..688 | 100 | Plus | |
2R | 20342007..20342449 | 1..443 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 16229512..16229954 | 1..443 | 100 | -> | Plus |
arm_2R | 16230017..16230261 | 444..688 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20343206..20343648 | 1..443 | 100 | -> | Plus |
2R | 20343711..20343955 | 444..688 | 100 | Plus |
Translation from 100 to 606
> IP08031.pep MKFYPNADVWFCVDKTSCLNSYQKYPPTHSWKIHDRTTAREMYYWRDIEG VKKTEIKLKDLYFTNWPKTRIRPQACLGLLYATGNRFIRLTKAPPAGFKC APLPVNLATARIVKVELRKKAKREKQAAKKAKKEAKKAKKAGKKGKGKGG NGDLKPKVIRTYEDAEKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12263-PA | 178 | GF12263-PA | 1..178 | 1..168 | 536 | 69.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22030-PA | 168 | GG22030-PA | 1..168 | 1..168 | 660 | 92.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20832-PA | 155 | GH20832-PA | 1..126 | 1..125 | 454 | 68.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG16739-PA | 168 | CG16739-PA | 1..168 | 1..168 | 904 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20935-PA | 156 | GI20935-PA | 1..120 | 1..119 | 429 | 66.7 | Plus |
Dmoj\GI20934-PA | 157 | GI20934-PA | 1..124 | 1..124 | 386 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17660-PA | 169 | GL17660-PA | 1..169 | 1..167 | 514 | 61.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14118-PA | 169 | GA14118-PA | 1..169 | 1..167 | 516 | 63.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22011-PA | 168 | GM22011-PA | 1..168 | 1..168 | 674 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11511-PA | 168 | GD11511-PA | 1..168 | 1..168 | 674 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20660-PA | 156 | GJ20660-PA | 1..120 | 1..119 | 446 | 69.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15977-PA | 169 | GK15977-PA | 1..124 | 1..124 | 528 | 74.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12107-PA | 168 | GE12107-PA | 1..168 | 1..168 | 654 | 91.1 | Plus |
Translation from 100 to 606
> IP08031.hyp MKFYPNADVWFCVDKTSCLNSYQKYPPTHSWKIHDRTTAREMYYWRDIEG VKKTEIKLKDLYFTNWPKTRIRPQACLGLLYATGNRFIRLTKAPPAGFKC APLPVNLATARIVKVELRKKAKREKQAAKKAKKEAKKAKKAGKKGKGKGG NGDLKPKVIRTYEDAEKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG16739-PA | 168 | CG16739-PA | 1..168 | 1..168 | 904 | 100 | Plus |