Clone IP08031 Report

Search the DGRC for IP08031

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:31
Vector:pOT2
Associated Gene/TranscriptCG16739-RA
Protein status:IP08031.pep: gold
Preliminary Size:685
Sequenced Size:706

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16739 2005-01-01 Successful iPCR screen
CG16739 2008-04-29 Release 5.5 accounting
CG16739 2008-08-15 Release 5.9 accounting
CG16739 2008-12-18 5.12 accounting

Clone Sequence Records

IP08031.complete Sequence

706 bp (706 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022435

> IP08031.complete
CAACATTTAGATGTTTTCTTTGAAAAAATAAAGGCAAAAAAATATCACTA
AATTTCGGTTTTAAATTTTGAATCGTGTGAACTTTAGTACAGAAGCCGCC
ATGAAGTTCTATCCGAATGCAGATGTCTGGTTCTGTGTGGACAAGACCAG
CTGCTTGAACAGCTATCAAAAGTATCCACCCACGCACAGCTGGAAGATTC
ACGATCGGACCACCGCGCGGGAAATGTACTATTGGCGCGACATCGAGGGC
GTGAAGAAGACGGAGATCAAGCTTAAGGATCTGTACTTCACCAATTGGCC
CAAAACCCGCATCCGTCCACAGGCCTGCTTGGGATTGCTCTATGCCACGG
GCAACAGATTCATCCGACTGACCAAGGCACCACCAGCGGGCTTCAAGTGT
GCACCACTGCCCGTCAATCTGGCCACCGCTCGAATTGTCAAAGTGGAGCT
GCGCAAGAAGGCGAAGCGCGAAAAACAGGCAGCTAAAAAGGCTAAAAAGG
AAGCGAAGAAGGCCAAGAAGGCGGGCAAAAAGGGCAAAGGAAAGGGCGGT
AATGGCGATCTTAAGCCAAAGGTCATTAGGACATACGAAGACGCCGAGAA
AGCATAATGATTACACATTATATTCAAATCCCGGTGTATTAAAGTGAATT
TCGATAATTTTTAAACGTTTTGAAGGCGTATAAAAAATAAAAAAAAAAAA
AAAAAA

IP08031.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG16739-RA 858 CG16739-RA 89..781 1..693 3450 99.8 Plus
CG16739.a 688 CG16739.a 69..675 87..693 3020 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16229024..16229466 1..443 2215 100 Plus
chr2R 21145070 chr2R 16229514..16229760 442..688 1205 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20342007..20342449 1..443 2215 100 Plus
2R 25286936 2R 20342510..20342761 442..693 1245 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20343206..20343648 1..443 2215 100 Plus
2R 25260384 2R 20343709..20343960 442..693 1245 99.6 Plus
Blast to na_te.dros performed 2019-03-16 06:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Cr1a 4470 Cr1a DMCR1A 4470bp 4288..4350 573..635 108 63.5 Plus

IP08031.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:39:06 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16229024..16229466 1..443 100 -> Plus
chr2R 16229516..16229760 444..688 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:34:40 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
CG16739-RA 1..507 101..607 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:59 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
CG16739-RA 1..507 101..607 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:27:28 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
CG16739-RA 1..507 101..607 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:31 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
CG16739-RA 1..507 101..607 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:22:16 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
CG16739-RA 1..507 101..607 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:46 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
CG16739-RA 1..667 22..688 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:59 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
CG16739-RA 1..667 22..688 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:27:28 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
CG16739-RA 15..695 1..681 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:31 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
CG16739-RA 1..667 22..688 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:22:16 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
CG16739-RA 15..695 1..681 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:39:06 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20342512..20342756 444..688 100   Plus
2R 20342007..20342449 1..443 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:39:06 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20342512..20342756 444..688 100   Plus
2R 20342007..20342449 1..443 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:39:06 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20342512..20342756 444..688 100   Plus
2R 20342007..20342449 1..443 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:27:28 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16229512..16229954 1..443 100 -> Plus
arm_2R 16230017..16230261 444..688 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:58 Download gff for IP08031.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20343206..20343648 1..443 100 -> Plus
2R 20343711..20343955 444..688 100   Plus

IP08031.pep Sequence

Translation from 100 to 606

> IP08031.pep
MKFYPNADVWFCVDKTSCLNSYQKYPPTHSWKIHDRTTAREMYYWRDIEG
VKKTEIKLKDLYFTNWPKTRIRPQACLGLLYATGNRFIRLTKAPPAGFKC
APLPVNLATARIVKVELRKKAKREKQAAKKAKKEAKKAKKAGKKGKGKGG
NGDLKPKVIRTYEDAEKA*

IP08031.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12263-PA 178 GF12263-PA 1..178 1..168 536 69.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22030-PA 168 GG22030-PA 1..168 1..168 660 92.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20832-PA 155 GH20832-PA 1..126 1..125 454 68.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG16739-PA 168 CG16739-PA 1..168 1..168 904 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20935-PA 156 GI20935-PA 1..120 1..119 429 66.7 Plus
Dmoj\GI20934-PA 157 GI20934-PA 1..124 1..124 386 60 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17660-PA 169 GL17660-PA 1..169 1..167 514 61.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14118-PA 169 GA14118-PA 1..169 1..167 516 63.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22011-PA 168 GM22011-PA 1..168 1..168 674 94.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11511-PA 168 GD11511-PA 1..168 1..168 674 94.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20660-PA 156 GJ20660-PA 1..120 1..119 446 69.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15977-PA 169 GK15977-PA 1..124 1..124 528 74.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12107-PA 168 GE12107-PA 1..168 1..168 654 91.1 Plus

IP08031.hyp Sequence

Translation from 100 to 606

> IP08031.hyp
MKFYPNADVWFCVDKTSCLNSYQKYPPTHSWKIHDRTTAREMYYWRDIEG
VKKTEIKLKDLYFTNWPKTRIRPQACLGLLYATGNRFIRLTKAPPAGFKC
APLPVNLATARIVKVELRKKAKREKQAAKKAKKEAKKAKKAGKKGKGKGG
NGDLKPKVIRTYEDAEKA*

IP08031.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG16739-PA 168 CG16739-PA 1..168 1..168 904 100 Plus