Clone IP08038 Report

Search the DGRC for IP08038

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:38
Vector:pOT2
Associated Gene/TranscriptCG17239-RA
Protein status:IP08038.pep: gold
Preliminary Size:747
Sequenced Size:790

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17239 2005-01-01 Successful iPCR screen
CG17239 2008-04-29 Release 5.5 accounting
CG17239 2008-08-15 Release 5.9 accounting
CG17239 2008-12-18 5.12 accounting

Clone Sequence Records

IP08038.complete Sequence

790 bp (790 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022431

> IP08038.complete
CACTAGTTGAAATGTTTGTGCAGTGGATTTTCCTGGCCTTCAGCGTCACC
GTGGTTTCCTCTAATTGGATTCCGGAACGAATCGTGGGAGGCGACTTGAT
AACCATTCTATCAGTTCCCTGGCAGGCTTCCATTCTTAGGCTTGGACGGT
TTCACTGCGGTGCAGCCATCTACAGTGAAGACATCGTCATAACGGCAGCC
CACTGCCTCACCGACCGCGAGACCGAGTTCCTCTCAGTGAGAGTCGGCTC
ATCGTTCACATTCTTCGGTGGTCAGGTGGTGAGGGTATCCAGTGTTCTGT
TACACGAGGAATACGACCAGTCCTGGTCCAACGACATAGCCGTGATGAGG
CTTCAGTCCAAGCTCCGGCTGGGAAGTGCAGTCAGTGTCATTCCCTTGGC
CGATACTCCCCCGGCCAGTGGATCACCTGCCACCGTTTCTGGATGGGGAG
CCATTGGTTTTAAGAAGAATTACCCCATGTCCATACTGTCCGCTTCGGTG
GACATTGTGGACCAGGATCAGTGTCGTAGGTCGTACGGAAGAAAAATCAC
CAAGGACATGATCTGTGCGGCCGCTCCAGGAAAGGATGCCTGCTCCGGCG
ATTCGGGAGGTCCTCTGGTCTCCGGTAACAAGCTCGTTGGGATCGTGTCC
TTTGGCAAGGAGTGCGCTCATCCCGAATATCCTGGAGTCTACGCTAACGT
GGCTGAGCTGAAGCCCTGGATTTTGGGCGCTATCGAAAGAATAACTAAAT
CTGAATAAATTAATTTACTTAAAAAAAAAAAAAAAAAAAA

IP08038.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG17239-RA 770 CG17239-RA 1..770 1..770 3850 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2251309..2252078 770..1 3760 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2251570..2252341 772..1 3860 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2251570..2252341 772..1 3860 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:44:59 has no hits.

IP08038.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:45:59 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2251309..2252078 1..770 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:34:41 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
CG17239-RA 1..747 12..758 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:00 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
CG17239-RA 1..747 12..758 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:45:00 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
CG17239-RA 1..747 12..758 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:32 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
CG17239-RA 1..747 12..758 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:20:07 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
CG17239-RA 1..747 12..758 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:49 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
CG17239-RA 1..747 12..758 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:00 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
CG17239-RA 1..770 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:45:00 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
CG17239-RA 1..770 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:32 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
CG17239-RA 1..747 12..758 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:20:07 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
CG17239-RA 1..770 1..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:45:59 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2251572..2252341 1..770 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:45:59 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2251572..2252341 1..770 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:45:59 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2251572..2252341 1..770 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:45:00 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2251572..2252341 1..770 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:59 Download gff for IP08038.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2251572..2252341 1..770 100   Minus

IP08038.hyp Sequence

Translation from 2 to 757

> IP08038.hyp
LVEMFVQWIFLAFSVTVVSSNWIPERIVGGDLITILSVPWQASILRLGRF
HCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFFGGQVVRVSSVLL
HEEYDQSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGA
IGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAPGKDACSGD
SGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERITKS
E*

IP08038.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG17239-PB 248 CG17239-PB 1..248 4..251 1286 100 Plus
CG17239-PA 248 CG17239-PA 1..248 4..251 1286 100 Plus
Ser12-PA 245 CG17240-PA 1..245 4..247 630 54.1 Plus
alphaTry-PA 256 CG18444-PA 30..256 26..247 530 49.8 Plus
gammaTry-PA 253 CG30028-PA 2..250 6..241 529 44.2 Plus

IP08038.pep Sequence

Translation from 2 to 757

> IP08038.pep
LVEMFVQWIFLAFSVTVVSSNWIPERIVGGDLITILSVPWQASILRLGRF
HCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFFGGQVVRVSSVLL
HEEYDQSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGA
IGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAPGKDACSGD
SGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERITKS
E*

IP08038.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15291-PA 246 GF15291-PA 2..246 4..247 726 56.7 Plus
Dana\GF13692-PA 261 GF13692-PA 34..261 26..247 526 49.6 Plus
Dana\GF12546-PA 256 GF12546-PA 1..256 5..247 486 45.7 Plus
Dana\GF12402-PA 256 GF12402-PA 30..249 26..240 485 47.3 Plus
Dana\GF12403-PA 256 GF12403-PA 1..256 5..247 468 44.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24538-PA 227 GG24538-PA 1..227 4..247 895 71.3 Plus
Dere\GG24539-PA 247 GG24539-PA 1..247 4..247 677 57.4 Plus
Dere\GG20381-PA 259 GG20381-PA 33..255 26..243 533 49.3 Plus
Dere\epsilonTry-PA 256 GG22660-PA 30..249 26..240 496 47.3 Plus
Dere\betaTry-PA 253 GG20194-PA 1..250 5..241 467 46 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22680-PA 258 GH22680-PA 30..258 26..247 493 46.3 Plus
Dgri\GH22924-PA 256 GH22924-PA 30..256 26..247 493 45.4 Plus
Dgri\GH13790-PA 261 GH13790-PA 34..249 26..241 493 52.7 Plus
Dgri\GH11999-PA 234 GH11999-PA 7..222 26..241 486 52.7 Plus
Dgri\GH22925-PA 254 GH22925-PA 30..250 26..241 484 47.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG17239-PB 248 CG17239-PB 1..248 4..251 1286 100 Plus
CG17239-PA 248 CG17239-PA 1..248 4..251 1286 100 Plus
Ser12-PA 245 CG17240-PA 1..245 4..247 630 54.1 Plus
alphaTry-PA 256 CG18444-PA 30..256 26..247 530 49.8 Plus
gammaTry-PA 253 CG30028-PA 2..250 6..241 529 44.2 Plus
CG30025-PA 253 CG30025-PA 2..250 6..241 529 44.2 Plus
deltaTry-PA 253 CG12351-PA 2..250 6..241 529 44.2 Plus
CG30031-PA 253 CG30031-PA 2..250 6..241 529 44.2 Plus
betaTry-PB 253 CG18211-PB 2..250 6..241 513 45 Plus
betaTry-PA 253 CG18211-PA 2..250 6..241 513 45 Plus
Ser8-PA 260 CG4812-PA 34..256 26..243 509 48 Plus
epsilonTry-PA 256 CG18681-PA 30..256 26..247 494 46.7 Plus
iotaTry-PA 252 CG7754-PA 27..252 26..247 464 43.6 Plus
CG11192-PB 279 CG11192-PB 6..259 5..240 426 39.8 Plus
CG17571-PB 258 CG17571-PB 30..258 26..247 418 41 Plus
CG17571-PA 258 CG17571-PA 30..258 26..247 418 41 Plus
thetaTry-PA 262 CG12385-PA 34..262 26..247 401 40.2 Plus
Send1-PA 255 CG17012-PA 1..244 4..245 400 38.2 Plus
CG31681-PA 264 CG31681-PA 27..255 25..246 398 41.1 Plus
CG17234-PA 251 CG17234-PA 1..250 4..247 387 38.2 Plus
Send2-PA 239 CG18125-PA 1..232 4..247 386 39.5 Plus
Try29F-PD 267 CG9564-PD 41..261 26..240 378 39.6 Plus
Try29F-PC 267 CG9564-PC 41..261 26..240 378 39.6 Plus
etaTry-PA 262 CG12386-PA 59..254 52..240 372 45.9 Plus
CG16998-PA 258 CG16998-PA 23..251 25..249 370 39.2 Plus
zetaTry-PA 280 CG12387-PA 38..273 26..240 368 38.1 Plus
lambdaTry-PA 272 CG12350-PA 35..260 26..244 363 37.4 Plus
CG32376-PA 291 CG32376-PA 63..290 24..246 356 37.6 Plus
CG17242-PA 245 CG17242-PA 1..237 4..245 355 36 Plus
CG17242-PB 245 CG17242-PB 1..237 4..245 355 36 Plus
CG7829-PA 253 CG7829-PA 27..245 26..240 354 37.4 Plus
CG3650-PA 249 CG3650-PA 17..249 18..246 348 37.2 Plus
CG11836-PI 281 CG11836-PI 44..275 26..245 341 35.6 Plus
CG11836-PJ 333 CG11836-PJ 96..327 26..245 341 35.6 Plus
CG4386-PA 372 CG4386-PA 123..354 23..240 340 35.6 Plus
CG18735-PA 364 CG18735-PA 82..311 26..240 338 37.1 Plus
CG32269-PB 332 CG32269-PB 101..324 19..239 336 37.2 Plus
CG32269-PA 332 CG32269-PA 101..324 19..239 336 37.2 Plus
CG32270-PA 259 CG32270-PA 30..257 26..246 333 38 Plus
CG13430-PB 267 CG13430-PB 31..266 26..247 333 38.4 Plus
CG13430-PA 267 CG13430-PA 31..266 26..247 333 38.4 Plus
CG31954-PA 277 CG31954-PA 50..271 26..240 329 35.9 Plus
CG32374-PA 299 CG32374-PA 66..292 19..240 326 35.1 Plus
CG9676-PA 251 CG9676-PA 10..245 9..240 325 33.3 Plus
CG8299-PA 260 CG8299-PA 16..252 15..240 325 35.3 Plus
CG34458-PA 257 CG34458-PA 4..251 2..240 322 33.1 Plus
CG1304-PA 260 CG1304-PA 31..253 26..240 322 33.2 Plus
CG10405-PB 268 CG10405-PB 36..262 26..240 321 38.2 Plus
CG33159-PA 257 CG33159-PA 1..240 1..234 316 35 Plus
CG32271-PA 248 CG32271-PA 17..242 19..240 314 36.6 Plus
Ser6-PA 259 CG2071-PA 13..253 10..240 314 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20607-PA 261 GI20607-PA 17..255 11..241 504 45.2 Plus
Dmoj\GI21243-PA 255 GI21243-PA 30..248 26..240 499 48.4 Plus
Dmoj\GI18413-PA 256 GI18413-PA 30..256 26..247 447 49.3 Plus
Dmoj\GI18353-PA 254 GI18353-PA 1..249 4..241 445 40.8 Plus
Dmoj\GI18414-PA 256 GI18414-PA 30..256 26..247 442 48.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17339-PA 256 GL17339-PA 1..256 5..247 515 46.1 Plus
Dper\GL17143-PA 256 GL17143-PA 1..256 5..247 498 45.7 Plus
Dper\GL17144-PA 252 GL17144-PA 19..252 19..247 487 43.6 Plus
Dper\GL17142-PA 256 GL17142-PA 1..256 5..247 480 44.5 Plus
Dper\GL17338-PA 256 GL17338-PA 1..249 5..240 476 44.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14937-PA 256 GA14937-PA 1..256 5..247 515 46.1 Plus
Dpse\GA24980-PA 256 GA24980-PA 1..256 5..247 497 45.7 Plus
Dpse\GA20562-PA 252 GA20562-PA 19..252 19..247 489 44 Plus
Dpse\GA15051-PA 256 GA15051-PA 1..249 5..240 487 44.6 Plus
Dpse\GA24979-PA 256 GA24979-PA 1..256 5..247 485 44.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18246-PA 248 GM18246-PA 1..248 4..251 1100 84.7 Plus
Dsec\GM21468-PA 260 GM21468-PA 34..260 26..247 515 47.6 Plus
Dsec\GM20441-PA 256 GM20441-PA 30..256 26..247 441 48 Plus
Dsec\GM18244-PA 255 GM18244-PA 1..247 4..248 434 40.2 Plus
Dsec\GM19789-PA 279 GM19789-PA 27..259 26..240 432 42.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22852-PA 248 GD22852-PA 1..248 4..251 1116 85.9 Plus
Dsim\GD22853-PA 245 GD22853-PA 1..245 4..247 662 55.3 Plus
Dsim\GD15412-PA 260 GD15412-PA 34..260 26..247 515 47.6 Plus
Dsim\GD15391-PA 253 GD15391-PA 30..250 26..241 469 47.5 Plus
Dsim\GD25907-PA 485 GD25907-PA 30..231 26..222 446 47 Plus
Dsim\GD25907-PA 485 GD25907-PA 259..485 26..247 424 48.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21575-PA 256 GJ21575-PA 27..255 21..247 530 48.7 Plus
Dvir\GJ21048-PA 259 GJ21048-PA 1..259 4..247 518 43.2 Plus
Dvir\GJ21498-PA 256 GJ21498-PA 30..250 26..241 505 50.2 Plus
Dvir\GJ20754-PA 253 GJ20754-PA 1..251 4..248 500 44.1 Plus
Dvir\GJ21573-PA 271 GJ21573-PA 30..263 25..250 467 45.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19007-PA 261 GK19007-PA 35..261 26..247 510 46.7 Plus
Dwil\GK21994-PA 256 GK21994-PA 30..249 26..240 501 48.2 Plus
Dwil\GK21995-PA 256 GK21995-PA 30..256 26..247 498 49.3 Plus
Dwil\GK19676-PA 244 GK19676-PA 18..244 26..247 480 49.3 Plus
Dwil\GK19675-PA 256 GK19675-PA 30..256 26..247 476 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15156-PA 244 GE15156-PA 1..244 4..247 939 73.8 Plus
Dyak\GE15166-PA 244 GE15166-PA 1..244 4..247 938 73.8 Plus
Dyak\GE15159-PA 244 GE15159-PA 1..244 4..247 654 55.5 Plus
Dyak\GE15822-PA 244 GE15822-PA 1..243 4..247 551 51 Plus
Dyak\GE12542-PA 259 GE12542-PA 33..259 26..247 517 48 Plus