Clone IP08039 Report

Search the DGRC for IP08039

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:39
Vector:pOT2
Associated Gene/TranscriptCG17242-RA
Protein status:IP08039.pep: gold
Preliminary Size:738
Sequenced Size:849

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17242 2005-01-01 Successful iPCR screen
CG17242 2008-04-29 Release 5.5 accounting
CG17242 2008-08-15 Release 5.9 accounting
CG17242 2008-12-18 5.12 accounting

Clone Sequence Records

IP08039.complete Sequence

849 bp (849 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022427

> IP08039.complete
GTGGTTGTAGAAAGTATTTCTTCAAAATGCTGCTCAAAGGCATTCTTCTA
TTAGTTTCCATTGCTCAAATAGCAGCAGATTTCAAATCGATTGGCATTGA
ACAAGCTCCCTGGCAGGCTTCCGTTCAAATAAACGACAAACATCACTGCG
GAGGAGTGATATACAGCGAAGATATCATCCTGACCATTGCCGAGTGTGTG
AGAAAGGCCAGATTGGAATTCATCTCGGTGCGAGTGGGGTCTGCCCAGGA
AAACGCCGGTGGCACTGTGCTGAAGGTCGAGAAGATGAGGCTGCAAGTAC
TTGGCCTGCGTCCCAGTGATGTGGCCATACTCCAGCTGAGATCGCCGCTG
TACTTGGACGGCGGAATTCGGGCCATTCCCTTGGCCACCATACCATTAGT
GCCGGGAACGAATGCCTCCGTTTCGGGTTGGGGTCAACTCTCTGCCATGA
ATCCTTCGTCGGAAGTTTTACTGAGAGTCGATGTAAAAATCCAAGATCAA
TTGATGTGCGCGACAAACCTTGCTCTGAAGGGCAGACTTATGAGTGTGGG
CGAGATCTGCGCAGCACCTGCGGGAGAAATTCCCTACGCCTGTCAAGGAT
TCGTCGGCGGTCCTTTGGTTGCCAATAATCGGCTGTATGGAATCCTTTCC
TGGCAAAGTGCCTGCGACGTCCTCAATAAATCTAGTGTCTATGCCAATAT
CGCGATGTTCAAAGTGTGGATTGAATCCACTGTTAAGCTAATGAATTTCT
TCAGAATAGGCTAGGCATTTTAAAACGACCTTTAAAATATACGTTTAAAA
AATCAACAGTTTGTGCTGCACAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP08039.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG17242-RA 821 CG17242-RA 1..821 1..821 4105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2268031..2268851 821..1 4075 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2268295..2269119 825..1 4125 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2268295..2269119 825..1 4125 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:08:39 has no hits.

IP08039.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:09:27 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2268031..2268851 1..821 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:34:42 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG17242-RA 1..738 27..764 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:24 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG17242-RA 1..738 27..764 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:43:21 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG17242-RB 1..738 27..764 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:57:52 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG17242-RA 1..738 27..764 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:11:25 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG17242-RB 1..738 27..764 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:09:36 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG17242-RA 1..738 27..764 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:24 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG17242-RA 1..821 1..821 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:43:21 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG17242-RB 1..821 1..821 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:57:52 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG17242-RA 1..738 27..764 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:11:25 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG17242-RB 22..842 1..821 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:27 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2268299..2269119 1..821 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:27 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2268299..2269119 1..821 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:27 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2268299..2269119 1..821 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:43:21 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2268299..2269119 1..821 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:21 Download gff for IP08039.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2268299..2269119 1..821 100   Minus

IP08039.pep Sequence

Translation from 2 to 763

> IP08039.pep
GCRKYFFKMLLKGILLLVSIAQIAADFKSIGIEQAPWQASVQINDKHHCG
GVIYSEDIILTIAECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQVL
GLRPSDVAILQLRSPLYLDGGIRAIPLATIPLVPGTNASVSGWGQLSAMN
PSSEVLLRVDVKIQDQLMCATNLALKGRLMSVGEICAAPAGEIPYACQGF
VGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWIESTVKLMNFF
RIG*

IP08039.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19703-PA 246 GF19703-PA 1..246 9..250 631 51.2 Plus
Dana\GF15291-PA 246 GF15291-PA 3..244 5..245 409 39.3 Plus
Dana\GF13692-PA 261 GF13692-PA 43..254 32..240 349 36 Plus
Dana\GF12548-PA 257 GF12548-PA 40..250 32..240 339 37.7 Plus
Dana\GF12402-PA 256 GF12402-PA 39..254 32..245 333 36.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24535-PA 244 GG24535-PA 13..244 21..253 943 75.1 Plus
Dere\GG20381-PA 259 GG20381-PA 42..252 32..240 363 38.5 Plus
Dere\GG21582-PA 258 GG21582-PA 35..254 28..243 334 38 Plus
Dere\GG24539-PA 247 GG24539-PA 1..245 9..245 327 35.1 Plus
Dere\GG24538-PA 227 GG24538-PA 1..225 9..245 325 33.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22924-PA 256 GH22924-PA 39..249 32..240 360 40.2 Plus
Dgri\GH22925-PA 254 GH22925-PA 39..254 32..245 354 38.1 Plus
Dgri\GH22926-PA 256 GH22926-PA 39..249 32..240 354 39.4 Plus
Dgri\GH22866-PA 255 GH22866-PA 39..255 32..247 340 35.6 Plus
Dgri\GH22928-PA 243 GH22928-PA 18..241 30..245 318 36.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG17242-PA 245 CG17242-PA 1..245 9..253 1238 100 Plus
CG17242-PB 245 CG17242-PB 1..245 9..253 1238 100 Plus
CG17239-PB 248 CG17239-PB 1..242 9..245 355 36 Plus
CG17239-PA 248 CG17239-PA 1..242 9..245 355 36 Plus
alphaTry-PA 256 CG18444-PA 39..252 32..243 344 38 Plus
Ser8-PA 260 CG4812-PA 43..253 32..240 338 35.7 Plus
iotaTry-PA 252 CG7754-PA 13..245 14..240 333 36.2 Plus
CG17571-PB 258 CG17571-PB 35..254 28..243 327 38 Plus
CG17571-PA 258 CG17571-PA 35..254 28..243 327 38 Plus
gammaTry-PA 253 CG30028-PA 39..251 32..242 320 35.8 Plus
deltaTry-PA 253 CG12351-PA 39..251 32..242 320 35.8 Plus
CG30031-PA 253 CG30031-PA 39..251 32..242 320 35.8 Plus
CG30025-PA 253 CG30025-PA 39..249 32..240 319 35.7 Plus
betaTry-PB 253 CG18211-PB 39..249 32..240 319 36.2 Plus
betaTry-PA 253 CG18211-PA 39..249 32..240 319 36.2 Plus
Ser12-PA 245 CG17240-PA 1..243 9..245 318 34.1 Plus
CG31681-PA 264 CG31681-PA 35..254 30..245 309 39.6 Plus
epsilonTry-PA 256 CG18681-PA 39..254 32..245 308 36.1 Plus
Send2-PA 239 CG18125-PA 1..229 9..244 307 35.5 Plus
Send1-PA 255 CG17012-PA 35..248 29..249 280 33.9 Plus
CG13430-PB 267 CG13430-PB 6..264 7..245 280 32.3 Plus
CG13430-PA 267 CG13430-PA 6..264 7..245 280 32.3 Plus
CG17234-PA 251 CG17234-PA 33..247 30..244 278 33.8 Plus
zetaTry-PA 280 CG12387-PA 47..277 32..244 253 33.6 Plus
etaTry-PA 262 CG12386-PA 59..254 49..240 248 35.9 Plus
CG11192-PB 279 CG11192-PB 36..260 32..241 246 34.8 Plus
CG7829-PA 253 CG7829-PA 36..249 32..244 240 28.9 Plus
thetaTry-PA 262 CG12385-PA 47..255 36..240 240 33.2 Plus
CG31954-PA 277 CG31954-PA 57..272 30..241 233 31.5 Plus
CG11836-PI 281 CG11836-PI 49..275 28..245 230 28.6 Plus
CG11836-PJ 333 CG11836-PJ 101..327 28..245 230 28.6 Plus
CG31269-PB 273 CG31269-PB 49..259 35..244 229 30.2 Plus
Try29F-PD 267 CG9564-PD 9..263 1..242 225 26.8 Plus
Try29F-PC 267 CG9564-PC 9..263 1..242 225 26.8 Plus
CG34458-PA 257 CG34458-PA 12..257 9..246 220 25.9 Plus
lambdaTry-PA 272 CG12350-PA 44..260 32..244 220 30.8 Plus
Sb-PB 787 CG4316-PB 548..787 28..245 213 31.5 Plus
Sb-PA 787 CG4316-PA 548..787 28..245 213 31.5 Plus
CG32271-PA 248 CG32271-PA 31..246 30..244 208 27.4 Plus
CG16998-PA 258 CG16998-PA 31..242 30..240 208 30 Plus
CG31265-PA 266 CG31265-PA 48..256 35..242 207 29.7 Plus
Phae1-PB 270 CG16996-PB 9..265 8..242 207 25.7 Plus
Phae1-PA 270 CG16996-PA 9..265 8..242 207 25.7 Plus
CG8299-PA 260 CG8299-PA 8..253 7..241 206 25.2 Plus
CG4271-PA 242 CG4271-PA 34..236 39..245 205 30.6 Plus
CG18223-PA 322 CG18223-PA 75..280 45..240 202 28.2 Plus
CG32376-PA 291 CG32376-PA 70..288 28..244 201 29.8 Plus
CG11836-PF 223 CG11836-PF 2..217 39..245 197 27.7 Plus
CG11836-PE 223 CG11836-PE 2..217 39..245 197 27.7 Plus
CG11836-PG 223 CG11836-PG 2..217 39..245 197 27.7 Plus
CG11836-PC 223 CG11836-PC 2..217 39..245 197 27.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21243-PA 255 GI21243-PA 39..251 32..243 366 39.4 Plus
Dmoj\GI18354-PA 254 GI18354-PA 33..251 28..243 343 38.9 Plus
Dmoj\GI18353-PA 254 GI18353-PA 33..251 28..243 335 38 Plus
Dmoj\GI20607-PA 261 GI20607-PA 44..261 32..247 306 34.1 Plus
Dmoj\GI18352-PA 287 GI18352-PA 64..279 28..240 297 36.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17144-PA 252 GL17144-PA 35..245 32..240 369 41.5 Plus
Dper\GL17338-PA 256 GL17338-PA 39..252 32..243 340 39.2 Plus
Dper\GL26041-PA 259 GL26041-PA 36..255 28..243 337 36.5 Plus
Dper\GL17339-PA 256 GL17339-PA 39..251 32..242 333 38.1 Plus
Dper\GL17143-PA 256 GL17143-PA 39..251 32..242 305 37.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20562-PA 252 GA20562-PA 35..245 32..240 368 41.5 Plus
Dpse\GA15051-PA 256 GA15051-PA 39..252 32..243 344 38.7 Plus
Dpse\GA23343-PA 259 GA23343-PA 36..255 28..243 335 36.5 Plus
Dpse\GA14937-PA 256 GA14937-PA 39..251 32..242 333 38.1 Plus
Dpse\GA24980-PA 256 GA24980-PA 39..251 32..242 304 37.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18242-PA 244 GM18242-PA 1..244 10..253 1149 89.3 Plus
Dsec\GM18246-PA 248 GM18246-PA 1..245 9..248 361 36.4 Plus
Dsec\GM21468-PA 260 GM21468-PA 43..253 32..240 340 34.7 Plus
Dsec\GM18244-PA 255 GM18244-PA 34..248 28..249 305 36 Plus
Dsec\GM20441-PA 256 GM20441-PA 39..254 32..245 282 37.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22848-PA 245 GD22848-PA 1..245 9..253 1149 90.2 Plus
Dsim\GD15412-PA 260 GD15412-PA 43..253 32..240 356 36.6 Plus
Dsim\GD22852-PA 248 GD22852-PA 1..237 9..240 353 37.2 Plus
Dsim\GD17824-PA 398 GD17824-PA 35..253 30..245 318 38.7 Plus
Dsim\GD22853-PA 245 GD22853-PA 1..243 9..245 313 35.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21575-PA 256 GJ21575-PA 36..253 28..245 361 39.9 Plus
Dvir\GJ20754-PA 253 GJ20754-PA 5..248 5..245 336 36.3 Plus
Dvir\GJ21573-PA 271 GJ21573-PA 9..264 14..250 334 35 Plus
Dvir\GJ18385-PA 258 GJ18385-PA 39..254 32..243 310 35 Plus
Dvir\GJ21497-PA 309 GJ21497-PA 96..302 36..240 306 38.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21994-PA 256 GK21994-PA 39..252 32..243 346 38.4 Plus
Dwil\GK21995-PA 256 GK21995-PA 39..254 32..245 318 37.6 Plus
Dwil\GK24139-PA 259 GK24139-PA 34..254 28..245 314 35.9 Plus
Dwil\GK24137-PA 259 GK24137-PA 38..255 32..245 311 35.6 Plus
Dwil\GK19007-PA 261 GK19007-PA 11..254 15..240 306 35.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15145-PA 245 GE15145-PA 12..245 20..253 924 71.8 Plus
Dyak\GE15156-PA 244 GE15156-PA 1..237 9..240 345 36.8 Plus
Dyak\GE12542-PA 259 GE12542-PA 42..252 32..240 345 36.4 Plus
Dyak\GE15166-PA 244 GE15166-PA 1..237 9..240 344 36.4 Plus
Dyak\GE12355-PA 254 GE12355-PA 36..247 32..240 341 37.1 Plus

IP08039.hyp Sequence

Translation from 2 to 763

> IP08039.hyp
GCRKYFFKMLLKGILLLVSIAQIAADFKSIGIEQAPWQASVQINDKHHCG
GVIYSEDIILTIAECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQVL
GLRPSDVAILQLRSPLYLDGGIRAIPLATIPLVPGTNASVSGWGQLSAMN
PSSEVLLRVDVKIQDQLMCATNLALKGRLMSVGEICAAPAGEIPYACQGF
VGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWIESTVKLMNFF
RIG*

IP08039.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG17242-PA 245 CG17242-PA 1..245 9..253 1238 100 Plus
CG17242-PB 245 CG17242-PB 1..245 9..253 1238 100 Plus
CG17239-PB 248 CG17239-PB 1..242 9..245 355 36 Plus
CG17239-PA 248 CG17239-PA 1..242 9..245 355 36 Plus
alphaTry-PA 256 CG18444-PA 39..252 32..243 344 38 Plus