Clone IP08040 Report

Search the DGRC for IP08040

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:40
Vector:pOT2
Associated Gene/TranscriptCG17279-RB
Protein status:IP08040.pep: gold
Preliminary Size:630
Sequenced Size:826

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17279 2005-01-01 Successful iPCR screen
CG17279 2008-04-29 Stopped prior to 5.5

Clone Sequence Records

IP08040.complete Sequence

826 bp assembled on 2011-08-31

GenBank Submission: BT128864.1

> IP08040.complete
GCTAATCGTATTCGTTTGCTGCCTGTGGATGGCCCCAAGTTTGGGACAGT
TGCCTCCTGAGATCGAGAAATGCAGGGCTGGCGATTCCATCTGCATAGCG
GAAACAGTCACCAGGATTCTGCGCTTGTATCCGAAGGGTCTGCCTTCCAT
TGGATTGGTTGCTCTGGACTCCATTGGATTCGAGGATGTCGTCGTTAGTC
GGTTGGAACCAGATGGGTCATCTACTTTTGATTTGAAATTCCCTAACCTA
ACCGTAATCGGATTCGCAGACTCCACAGTGACGGAGGCAAAGGGATTCGA
TGCGGATTTGCCTCGGGTCCTCGAGTTGAGTGGCTGGATTCCATTGCTGA
AACTCAATGGAACTTACGAGATGAGGGGCAGTTTGCTGACTATGCCCATT
CATGGCAAAGGTCAAGCCAAGGTGGAGATCAGAGAATGCCGCGTTCGTTG
CAAAGTGCGAGTTCTGGAGGATCTCCGAGACGATGGCAAGCTATATGCCG
GAATATCCAAGGTCAAGTGCTTGCTGGATGTGCAGGGCATGCACTTGAAC
TTGGAAAATCTTTTCAACAATCCTGAAATGAGCGATGCCATGAACGTTGT
GGCCAACACAAAGTGGCTGGAAATTTGGCATAACCTTCGCAGGGGTATCA
CCTCTGCGGTGGATCAGTTGGTCGAGTCGATTCTCCAGCGAGTAGCTAAT
AAGTTACCATATGACGATTTGTATAGGGACTGAAAGTACAACACATATTT
GATTTAAAAACAGTTATGAGAAATGGTTAAATGTTATATGATTAATACTG
TTCTTCAAATAAAAAAAAAAAAAAAA

IP08040.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16874211..16874694 537..54 2390 99.6 Minus
chr3R 27901430 chr3R 16873877..16874152 810..537 1240 97.5 Minus
chr3R 27901430 chr3R 16874756..16874808 53..1 265 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21050346..21050829 537..54 2405 99.8 Minus
3R 32079331 3R 21050013..21050287 811..537 1375 100 Minus
3R 32079331 3R 21050891..21050943 53..1 265 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20791177..20791660 537..54 2405 99.7 Minus
3R 31820162 3R 20790844..20791118 811..537 1375 100 Minus
3R 31820162 3R 20791722..20791774 53..1 265 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:58:37 has no hits.

IP08040.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:59:19 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16873877..16874151 538..810 97 <- Minus
chr3R 16874211..16874694 54..537 99 <- Minus
chr3R 16874756..16874808 1..53 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-31 13:25:32 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG17279-RB 1..705 29..733 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:31:41 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG17279-RB 1..705 29..733 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:18:03 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG17279-RB 1..705 29..733 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-31 13:25:32 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG17279-RB 1..782 29..810 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:31:41 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG17279-RB 1..810 1..810 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:18:03 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG17279-RB 1..810 1..810 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:19 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21050014..21050286 538..810 100 <- Minus
3R 21050346..21050829 54..537 99 <- Minus
3R 21050891..21050943 1..53 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:19 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21050014..21050286 538..810 100 <- Minus
3R 21050346..21050829 54..537 99 <- Minus
3R 21050891..21050943 1..53 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:19 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21050014..21050286 538..810 100 <- Minus
3R 21050346..21050829 54..537 99 <- Minus
3R 21050891..21050943 1..53 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:31:41 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16875736..16876008 538..810 100 <- Minus
arm_3R 16876068..16876551 54..537 99 <- Minus
arm_3R 16876613..16876665 1..53 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:47:32 Download gff for IP08040.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20790845..20791117 538..810 100 <- Minus
3R 20791177..20791660 54..537 99 <- Minus
3R 20791722..20791774 1..53 100   Minus

IP08040.hyp Sequence

Translation from 0 to 732

> IP08040.hyp
LIVFVCCLWMAPSLGQLPPEIEKCRAGDSICIAETVTRILRLYPKGLPSI
GLVALDSIGFEDVVVSRLEPDGSSTFDLKFPNLTVIGFADSTVTEAKGFD
ADLPRVLELSGWIPLLKLNGTYEMRGSLLTMPIHGKGQAKVEIRECRVRC
KVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFNNPEMSDAMNVV
ANTKWLEIWHNLRRGITSAVDQLVESILQRVANKLPYDDLYRD*

IP08040.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17279-PB 234 CG17279-PB 1..234 10..243 1209 100 Plus
CG11854-PB 250 CG11854-PB 7..248 1..241 314 28.8 Plus
CG17279-PC 159 CG17279-PC 1..82 10..91 309 78 Plus
CG31189-PB 258 CG31189-PB 7..248 2..241 295 28.8 Plus
CG11852-PA 250 CG11852-PA 9..247 2..241 281 28.8 Plus

IP08040.pep Sequence

Translation from 1 to 732

> IP08040.pep
LIVFVCCLWMAPSLGQLPPEIEKCRAGDSICIAETVTRILRLYPKGLPSI
GLVALDSIGFEDVVVSRLEPDGSSTFDLKFPNLTVIGFADSTVTEAKGFD
ADLPRVLELSGWIPLLKLNGTYEMRGSLLTMPIHGKGQAKVEIRECRVRC
KVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFNNPEMSDAMNVV
ANTKWLEIWHNLRRGITSAVDQLVESILQRVANKLPYDDLYRD*

IP08040.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17554-PA 254 GF17554-PA 13..250 6..241 295 29.3 Plus
Dana\GF18524-PA 253 GF18524-PA 18..248 14..241 274 28.4 Plus
Dana\GF18525-PA 258 GF18525-PA 16..247 11..241 261 26.6 Plus
Dana\GF18526-PA 258 GF18526-PA 22..247 17..241 261 28.4 Plus
Dana\GF17552-PA 250 GF17552-PA 6..247 2..241 256 27 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:30:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14959-PA 213 GG14959-PA 1..213 10..243 978 80.8 Plus
Dere\GG11380-PA 250 GG11380-PA 23..248 17..241 309 30.4 Plus
Dere\GG11378-PA 250 GG11378-PA 9..249 2..243 299 29.3 Plus
Dere\GG14982-PA 258 GG14982-PA 5..247 1..241 291 28.7 Plus
Dere\GG14993-PA 263 GG14993-PA 4..253 1..241 283 27.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17382-PA 259 GH17382-PA 24..252 16..243 279 27 Plus
Dgri\GH17380-PA 248 GH17380-PA 14..245 11..241 263 27.6 Plus
Dgri\GH16804-PA 243 GH16804-PA 10..233 20..241 255 27.6 Plus
Dgri\GH23203-PA 234 GH23203-PA 1..222 21..241 249 26.5 Plus
Dgri\GH17381-PA 246 GH17381-PA 18..246 15..243 225 24.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG17279-PD 245 CG17279-PD 3..245 1..243 1264 100 Plus
CG11854-PB 250 CG11854-PB 7..248 1..241 314 28.8 Plus
CG31189-PB 258 CG31189-PB 7..248 2..241 295 28.8 Plus
CG11852-PA 250 CG11852-PA 9..247 2..241 281 28.8 Plus
CG31207-PA 258 CG31207-PA 5..247 1..241 280 29.5 Plus
CG7079-PB 255 CG7079-PB 21..248 16..241 267 27.9 Plus
CG7079-PA 255 CG7079-PA 21..248 16..241 267 27.9 Plus
CG2650-PA 260 CG2650-PA 30..257 18..241 231 25.4 Plus
to-PB 249 CG11853-PB 9..247 5..243 214 25.3 Plus
to-PA 249 CG11853-PA 9..247 5..243 214 25.3 Plus
CG10407-PB 259 CG10407-PB 28..256 11..240 198 23.1 Plus
CG10407-PA 259 CG10407-PA 28..256 11..240 198 23.1 Plus
CG13618-PA 252 CG13618-PA 27..250 16..241 188 22.3 Plus
CG10407-PC 263 CG10407-PC 28..260 11..240 183 22.7 Plus
CG17189-PC 271 CG17189-PC 27..248 18..236 171 23.2 Plus
CG17189-PB 271 CG17189-PB 27..248 18..236 171 23.2 Plus
CG14457-PB 271 CG14457-PB 10..248 1..236 168 24.4 Plus
CG14259-PA 289 CG14259-PA 43..271 18..243 167 23 Plus
CG14457-PC 270 CG14457-PC 10..247 1..236 161 24.8 Plus
CG14661-PB 246 CG14661-PB 11..244 1..241 160 23.7 Plus
CG14661-PA 246 CG14661-PA 11..244 1..241 160 23.7 Plus
CG2016-PD 249 CG2016-PD 39..244 31..239 158 20.3 Plus
CG2016-PB 249 CG2016-PB 39..244 31..239 158 20.3 Plus
CG10264-PA 270 CG10264-PA 41..264 14..236 157 22.7 Plus
CG2016-PE 254 CG2016-PE 39..249 31..239 147 19.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10309-PA 228 GI10309-PA 1..223 20..241 313 32.3 Plus
Dmoj\GI10308-PA 253 GI10308-PA 6..247 1..241 301 30 Plus
Dmoj\GI10307-PA 256 GI10307-PA 22..248 17..241 289 30.7 Plus
Dmoj\GI23926-PA 238 GI23926-PA 1..237 8..243 269 27.3 Plus
Dmoj\GI16254-PA 228 GI16254-PA 1..225 21..241 248 27 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12686-PA 243 GL12686-PA 3..243 1..243 777 59.4 Plus
Dper\GL11987-PA 250 GL11987-PA 9..247 2..241 310 31.2 Plus
Dper\GL12689-PA 262 GL12689-PA 4..249 2..241 301 27.9 Plus
Dper\GL12687-PA 256 GL12687-PA 23..249 17..241 287 29.8 Plus
Dper\GL12688-PA 258 GL12688-PA 4..247 1..241 285 28.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27589-PA 227 GA27589-PA 4..227 17..243 743 59.5 Plus
Dpse\GA11236-PA 250 GA11236-PA 9..247 2..241 310 31.2 Plus
Dpse\GA16076-PA 262 GA16076-PA 4..249 2..241 300 27.9 Plus
Dpse\GA20085-PA 256 GA20085-PA 23..249 17..241 287 29.8 Plus
Dpse\GA16093-PA 258 GA16093-PA 4..247 1..241 282 28.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15110-PA 224 GM15110-PA 3..224 1..243 1083 86.4 Plus
Dsec\GM17820-PA 250 GM17820-PA 9..247 2..241 290 28.3 Plus
Dsec\GM17823-PA 246 GM17823-PA 14..243 11..240 289 31.9 Plus
Dsec\GM15112-PA 258 GM15112-PA 5..247 1..241 284 28.7 Plus
Dsec\GM15113-PA 263 GM15113-PA 31..253 20..241 281 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21191-PA 250 GD21191-PA 13..248 7..241 320 30.4 Plus
Dsim\GD21189-PA 250 GD21189-PA 9..247 2..241 294 28.7 Plus
Dsim\GD20016-PA 258 GD20016-PA 5..247 1..241 284 28.7 Plus
Dsim\GD20015-PA 255 GD20015-PA 21..248 16..241 268 27.9 Plus
Dsim\GD24605-PA 260 GD24605-PA 29..259 17..243 239 24.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10160-PA 675 GJ10160-PA 519..673 90..243 435 47.1 Plus
Dvir\GJ16719-PA 257 GJ16719-PA 27..257 17..243 324 31.2 Plus
Dvir\GJ10162-PA 257 GJ10162-PA 3..247 2..241 302 28.5 Plus
Dvir\GJ10161-PA 258 GJ10161-PA 5..248 1..241 296 29.7 Plus
Dvir\GJ24020-PA 255 GJ24020-PA 27..254 17..243 292 27.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13452-PA 254 GK13452-PA 7..253 1..243 339 29.8 Plus
Dwil\GK19974-PA 256 GK19974-PA 25..256 16..243 291 28 Plus
Dwil\GK14318-PA 261 GK14318-PA 22..248 16..241 264 27.3 Plus
Dwil\GK14315-PA 258 GK14315-PA 5..247 1..241 257 26.2 Plus
Dwil\GK13450-PA 250 GK13450-PA 9..247 2..241 254 27.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25021-PA 245 GE25021-PA 3..245 1..243 1125 86.8 Plus
Dyak\GE23577-PA 250 GE23577-PA 7..248 1..241 327 29.2 Plus
Dyak\GE23575-PA 251 GE23575-PA 10..248 2..241 298 29.1 Plus
Dyak\GE25023-PA 258 GE25023-PA 19..247 15..241 275 27.8 Plus
Dyak\GE25022-PA 254 GE25022-PA 7..248 2..241 271 26.7 Plus