Clone IP08047 Report

Search the DGRC for IP08047

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:47
Vector:pOT2
Associated Gene/TranscriptCG17917-RA
Protein status:IP08047.pep: gold
Preliminary Size:636
Sequenced Size:712

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17917 2005-01-01 Successful iPCR screen
CG17917 2008-04-29 Release 5.5 accounting
CG17917 2008-08-15 Release 5.9 accounting
CG17917 2008-12-18 5.12 accounting

Clone Sequence Records

IP08047.complete Sequence

712 bp (712 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022423

> IP08047.complete
GCTAGCATATGTATCCTACTTTTCATGCGATTCGCGCCAAGCTTGAGCCT
CAAATCAACTAGAGGAGTTCATCAGTCGGATACGGAAGTGAGCAAGATCA
TGAGGTCCTTGGATGTGATACCAGATGTAATACACATCGGACCGCAGGAG
TTTCTTAATGTTACTTACCACGGGCATTTAGCAGCACATTGTGGAAAGGT
ACTGGAACCCATGCAAGTGCGTGATGAACCCTCCGTAAAGTGGCCCTCGG
CACCGGAAAACTACTACGCCCTGCTGATGGTGGATCCGGACGTACCCAAT
GCTATAACACCCACGCACCGGGAGTTCCTACACTGGATGGTCCTCAACAT
ACCCGGCAATCTGTTGGCCCTTGGGGACGTGCGCGTGGGATACATGGGTG
CCACTCCGCTGAAGGGGACCGGAACCCATCGGTTCGTCTTCCTGCTCTAC
AAACAGAGGGACTACACCAAGTTTGACTTCCCGAAACTGCCGAAGCACTC
GGTTAAGGGTCGCAGTGGCTTTGAAACCAAGCGGTTCGCAAAGAAATACA
GATTTGGCCATCCGGTAGCTGGGAACTTCTTCACATCCCAATGGAGCCCC
GATGTCCCATCCCTTATCAAAGCCATCTCGCACAATGCCCGTCAAGTAGC
ACACTTTTGAATTTAGAGTCCAGCTTCCAATAAAAATAATTCCAAATAAA
AAAAAAAAAAAA

IP08047.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG17917.a 857 CG17917.a 161..857 1..697 3485 100 Plus
CG17917-RA 857 CG17917-RA 161..857 1..697 3485 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2168013..2168550 160..697 2690 100 Plus
chr3R 27901430 chr3R 2167654..2167814 1..161 805 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6342336..6342874 160..698 2695 100 Plus
3R 32079331 3R 6341977..6342137 1..161 805 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6083167..6083705 160..698 2695 100 Plus
3R 31820162 3R 6082808..6082968 1..161 805 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:03:58 has no hits.

IP08047.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:04:40 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2167654..2167812 1..159 100 -> Plus
chr3R 2168013..2168550 160..697 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:34:44 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17917-RA 1..636 25..660 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:01:02 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17917-RA 1..636 25..660 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:48:11 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17917-RA 1..636 25..660 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:41:33 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17917-RA 1..636 25..660 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:57:28 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17917-RA 1..636 25..660 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:44:28 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17917-RA 1..636 25..660 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:01:02 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17917-RA 10..706 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:48:11 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17917-RA 10..706 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:41:34 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17917-RA 1..636 25..660 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:57:28 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
CG17917-RA 10..706 1..697 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:40 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6341977..6342135 1..159 100 -> Plus
3R 6342336..6342873 160..697 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:40 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6341977..6342135 1..159 100 -> Plus
3R 6342336..6342873 160..697 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:40 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6341977..6342135 1..159 100 -> Plus
3R 6342336..6342873 160..697 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:48:11 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2167699..2167857 1..159 100 -> Plus
arm_3R 2168058..2168595 160..697 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:32 Download gff for IP08047.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6083167..6083704 160..697 100   Plus
3R 6082808..6082966 1..159 100 -> Plus

IP08047.hyp Sequence

Translation from 0 to 659

> IP08047.hyp
ASICILLFMRFAPSLSLKSTRGVHQSDTEVSKIMRSLDVIPDVIHIGPQE
FLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPDVPN
AITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLY
KQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSP
DVPSLIKAISHNARQVAHF*

IP08047.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG17917-PA 211 CG17917-PA 1..211 9..219 1134 100 Plus
CG17919-PA 202 CG17919-PA 20..202 30..212 417 44.3 Plus
CG10298-PA 187 CG10298-PA 13..184 39..210 413 44.8 Plus
CG6180-PA 257 CG6180-PA 75..255 29..209 401 44.2 Plus
a5-PA 210 CG5430-PA 22..205 26..209 377 36.4 Plus

IP08047.pep Sequence

Translation from 0 to 659

> IP08047.pep
ASICILLFMRFAPSLSLKSTRGVHQSDTEVSKIMRSLDVIPDVIHIGPQE
FLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPDVPN
AITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLY
KQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSP
DVPSLIKAISHNARQVAHF*

IP08047.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19876-PA 217 GF19876-PA 6..205 4..209 727 61.2 Plus
Dana\GF16396-PA 202 GF16396-PA 18..202 28..212 429 42.7 Plus
Dana\GF14208-PA 260 GF14208-PA 75..258 26..209 414 43.5 Plus
Dana\GF16395-PA 186 GF16395-PA 2..184 28..210 411 41.5 Plus
Dana\GF23379-PA 176 GF23379-PA 1..175 34..209 367 40.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13325-PA 221 GG13325-PA 3..221 1..219 1104 93.6 Plus
Dere\GG13347-PA 202 GG13347-PA 16..202 25..212 428 44.7 Plus
Dere\GG13336-PA 187 GG13336-PA 13..184 39..210 417 44.2 Plus
Dere\GG23796-PA 178 GG23796-PA 1..177 34..210 393 42.9 Plus
Dere\GG11139-PA 176 GG11139-PA 1..176 34..210 385 41.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14038-PA 223 GH14038-PA 23..211 20..208 606 61.9 Plus
Dgri\GH14039-PA 186 GH14039-PA 3..184 29..210 418 40.1 Plus
Dgri\GH13213-PA 178 GH13213-PA 1..177 34..210 404 43.5 Plus
Dgri\GH14040-PA 202 GH14040-PA 20..202 30..212 394 41 Plus
Dgri\GH22236-PA 176 GH22236-PA 1..171 34..205 378 42.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG17917-PA 211 CG17917-PA 1..211 9..219 1134 100 Plus
CG17919-PA 202 CG17919-PA 20..202 30..212 417 44.3 Plus
CG10298-PA 187 CG10298-PA 13..184 39..210 413 44.8 Plus
CG6180-PA 257 CG6180-PA 75..255 29..209 401 44.2 Plus
a5-PA 210 CG5430-PA 22..205 26..209 377 36.4 Plus
Pebp1-PA 176 CG18594-PA 1..175 34..209 372 41.8 Plus
CG7054-PA 179 CG7054-PA 3..177 38..209 305 38.1 Plus
CG30060-PA 202 CG30060-PA 23..179 39..198 252 35 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24412-PA 223 GI24412-PA 31..212 27..208 603 60.4 Plus
Dmoj\GI24413-PA 183 GI24413-PA 10..181 39..210 432 43 Plus
Dmoj\GI24414-PA 202 GI24414-PA 29..200 39..210 413 44.2 Plus
Dmoj\GI14504-PA 178 GI14504-PA 1..177 34..210 396 42.4 Plus
Dmoj\GI18941-PA 187 GI18941-PA 13..186 29..202 380 41.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24075-PA 220 GL24075-PA 22..211 26..215 659 62.6 Plus
Dper\GL24079-PA 203 GL24079-PA 1..203 9..212 446 43.6 Plus
Dper\GL24078-PA 189 GL24078-PA 2..186 26..210 433 43.2 Plus
Dper\GL19726-PA 256 GL19726-PA 75..254 30..209 395 42.2 Plus
Dper\GL24219-PA 179 GL24219-PA 3..171 38..203 352 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14723-PA 220 GA14723-PA 22..211 26..215 663 62.6 Plus
Dpse\GA14724-PA 203 GA14724-PA 1..203 9..212 451 44.1 Plus
Dpse\GA10227-PA 189 GA10227-PA 2..186 26..210 431 42.7 Plus
Dpse\GA19416-PA 256 GA19416-PA 75..254 30..209 395 42.2 Plus
Dpse\GA15006-PA 176 GA15006-PA 1..175 34..209 367 40.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10885-PA 211 GM10885-PA 1..211 9..219 1105 97.2 Plus
Dsec\GM10887-PA 202 GM10887-PA 18..202 28..212 425 43.8 Plus
Dsec\GM10048-PA 178 GM10048-PA 1..177 34..210 400 44.1 Plus
Dsec\GM10886-PA 187 GM10886-PA 13..184 39..210 400 44.8 Plus
Dsec\GM26437-PA 176 GM26437-PA 1..176 34..210 387 41.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19864-PA 221 GD19864-PA 3..221 1..219 1137 96.8 Plus
Dsim\GD19866-PA 202 GD19866-PA 20..202 30..212 436 45.9 Plus
Dsim\GD19865-PA 187 GD19865-PA 13..184 39..210 405 44.8 Plus
Dsim\GD23851-PA 178 GD23851-PA 1..177 34..210 400 44.1 Plus
Dsim\GD20954-PA 176 GD20954-PA 1..176 34..210 385 41.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14270-PA 218 GJ14270-PA 26..217 26..217 613 57.3 Plus
Dvir\GJ14271-PA 186 GJ14271-PA 13..184 39..210 420 42.4 Plus
Dvir\GJ16279-PA 226 GJ16279-PA 49..224 34..209 405 42.6 Plus
Dvir\GJ21315-PA 188 GJ21315-PA 13..185 29..201 385 42.8 Plus
Dvir\GJ14338-PA 176 GJ14338-PA 1..171 34..205 380 43 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13054-PA 211 GK13054-PA 6..211 4..210 664 60.9 Plus
Dwil\GK13056-PA 202 GK13056-PA 19..201 30..211 448 47 Plus
Dwil\GK13055-PA 191 GK13055-PA 4..188 25..210 416 43.5 Plus
Dwil\GK14662-PA 256 GK14662-PA 47..254 11..209 415 39.9 Plus
Dwil\GK11698-PA 176 GK11698-PA 1..171 34..205 390 43.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10209-PA 221 GE10209-PA 3..221 1..219 1085 92.2 Plus
Dyak\GE10211-PA 202 GE10211-PA 20..202 30..212 420 44.8 Plus
Dyak\GE10210-PA 187 GE10210-PA 13..184 39..210 418 44.2 Plus
Dyak\GE18600-PA 178 GE18600-PA 1..177 34..210 398 42.9 Plus
Dyak\GE10305-PA 176 GE10305-PA 1..176 34..210 378 41 Plus