Clone IP08053 Report

Search the DGRC for IP08053

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:53
Vector:pOT2
Associated Gene/TranscriptCG18336-RA
Protein status:IP08053.pep: gold
Preliminary Size:689
Sequenced Size:495

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18336 2005-01-01 Successful iPCR screen
CG18336 2008-04-29 Release 5.5 accounting
CG18336 2008-08-15 Release 5.9 accounting
CG18336 2008-12-18 5.12 accounting

Clone Sequence Records

IP08053.complete Sequence

495 bp (495 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022411

> IP08053.complete
ATCAACAATTTTTGCGGAAATAAAAAACATGTCCTATTCCAGCCGATTTG
GTTTCGACTTCCATCTGCCGGATGAGGGATGGTGCTACCCGAAGAACGAC
ATGCATTTCATCCGCAGCGCGGAATGGGTGCCCGTGGAGAAGGCAGGCGT
GGGCCGCTCATTCGCCAATCCCAATGGCGTGATCTATCCGCGGGTGGTAG
GCATGATTCCACGCTACGGCGGCCACGTTCCGGGCAACAAATTTCGTGTG
GGCAACACCTATGGCCGTTCCACCATCGACGCCAAGCGTCATCTGGCCCT
CAATCATGATTGAGGACCGAGTTATCGGAACACTCACTCACCATTAGCCA
ATCAAATTCGCTGTGTTACGCTTACAGAAGCACCCGAAATAAATCGTATC
CAGTAGAAGCCTGTAGAAAATGGCAAATAGAAATAAAATCATACAAATTC
AAATGTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP08053.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG18336-RA 797 CG18336-RA 294..758 1..465 2295 99.5 Plus
CG18336.a 1003 CG18336.a 500..964 1..465 2295 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7181217..7181629 457..45 2035 99.5 Minus
chr2R 21145070 chr2R 7181690..7181734 45..1 225 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11293768..11294188 465..45 2075 99.5 Minus
2R 25286936 2R 11294249..11294293 45..1 225 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11294967..11295387 465..45 2075 99.5 Minus
2R 25260384 2R 11295448..11295492 45..1 225 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:57:40 has no hits.

IP08053.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:58:53 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7181217..7181629 45..457 99 <- Minus
chr2R 7181691..7181734 1..44 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:34:47 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
CG18336-RA 1..285 29..313 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:03 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
CG18336-RA 1..285 29..313 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:24:43 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
CG18336-RA 1..285 29..313 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:35 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
CG18336-RA 1..285 29..313 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:37 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
CG18336-RA 1..285 29..313 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:54 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
CG18336-RA 294..743 1..450 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:03 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
CG18336-RA 294..750 1..457 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:24:43 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
CG18336-RA 294..750 1..457 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:35 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
CG18336-RA 294..743 1..450 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:37 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
CG18336-RA 294..750 1..457 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:58:53 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294250..11294293 1..44 100   Minus
2R 11293776..11294188 45..457 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:58:53 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294250..11294293 1..44 100   Minus
2R 11293776..11294188 45..457 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:58:53 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294250..11294293 1..44 100   Minus
2R 11293776..11294188 45..457 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:24:43 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7181281..7181693 45..457 100 <- Minus
arm_2R 7181755..7181798 1..44 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:02 Download gff for IP08053.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294975..11295387 45..457 100 <- Minus
2R 11295449..11295492 1..44 100   Minus

IP08053.hyp Sequence

Translation from 0 to 312

> IP08053.hyp
STIFAEIKNMSYSSRFGFDFHLPDEGWCYPKNDMHFIRSAEWVPVEKAGV
GRSFANPNGVIYPRVVGMIPRYGGHVPGNKFRVGNTYGRSTIDAKRHLAL
NHD*

IP08053.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG18336-PB 94 CG18336-PB 1..94 10..103 527 100 Plus
CG18336-PA 94 CG18336-PA 1..94 10..103 527 100 Plus

IP08053.pep Sequence

Translation from 1 to 312

> IP08053.pep
STIFAEIKNMSYSSRFGFDFHLPDEGWCYPKNDMHFIRSAEWVPVEKAGV
GRSFANPNGVIYPRVVGMIPRYGGHVPGNKFRVGNTYGRSTIDAKRHLAL
NHD*

IP08053.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12415-PA 94 GF12415-PA 1..94 10..103 473 92.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22674-PA 94 GG22674-PA 1..94 10..103 504 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21931-PA 93 GH21931-PA 1..93 10..103 350 71.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG18336-PB 94 CG18336-PB 1..94 10..103 527 100 Plus
CG18336-PA 94 CG18336-PA 1..94 10..103 527 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19639-PA 93 GI19639-PA 1..93 10..103 349 70.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16740-PA 94 GL16740-PA 1..94 10..103 419 80.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14894-PA 94 GA14894-PA 1..94 10..103 415 79.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20452-PA 94 GM20452-PA 1..94 10..103 504 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25920-PA 94 GD25920-PA 1..94 10..103 504 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15005-PA 93 GJ15005-PA 1..93 10..103 350 68.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21619-PA 94 GK21619-PA 1..94 10..103 419 80.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13029-PA 94 GE13029-PA 1..94 10..103 504 100 Plus