Clone IP08069 Report

Search the DGRC for IP08069

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:69
Vector:pOT2
Associated Gene/TranscriptCG30184-RA
Protein status:IP08069.pep: gold
Preliminary Size:672
Sequenced Size:795

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30184 2005-01-01 Successful iPCR screen
CG30184 2008-04-29 Release 5.5 accounting
CG30184 2008-08-15 Release 5.9 accounting
CG30184 2008-12-18 5.12 accounting

Clone Sequence Records

IP08069.complete Sequence

795 bp (795 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022395

> IP08069.complete
ATACTATATATCTTGTCACAATTGTAGTATAACCATTTAATCGGGCAAAC
ATGCAGGTGCGCTCCAAGAAGCCCGTTTGGTTCCTGTTCAAGATGATGGA
GCTGCTGCTGAGCCTGGGCTGCTGCCTCGTCCATTGGACCTGCTTCATGG
AGGAGGGTGTGCCGCACATCTTCCTGCTGTGCGGAACGTACGGCGGCTCG
GTGATCATATGCTTCATATCACTGATTGGAGCTTTCTACGCCGAGCGGCC
GACGATGAAGCACGAGGCGCTGTTCGGTGGGATCTTGGGTGGCCTGCACA
TGGTCACCGTGTACGCCAACATGTATGTGGCCACTTTGGAGGAGTTCCGC
ACTGAGCGCTGGCCCAGCTTCTATGCGTGCTGTCGGGACAACGCCATTGT
GGCTCTGTACGCCGGCGCCATTTATCTGATGCACTGCACCTTCGCTCTGG
ATCTCATGTTCTCCCACTCACGCAGTCGGGCGAATCAGAAGATGCATCCA
CAGCGGAGCAAGCGACCACTGCAGCTGTACTTCATCAGCCGGGGCGCGGA
GGCCTATCTCAGTCGCTTCTGGTTCTTTCGGCGCATCGCCGCCAGGATGC
TGACCAGCGCCCAGCCATCGGAGCATTCCGGCCGGAAGCGGCAGGTCTCG
TCCTCCGAGTCGGACTCGGATGCCAAGGAGAGGGAGGAGGAGCGGATTAG
GAACTCGGAGGTTTTCAAATAGCTCAAGTAATTAAATATTAACGTTCACC
TGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP08069.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG30184-RA 672 CG30184-RA 1..672 51..722 3360 100 Plus
Pi3K59F-RA 3202 Pi3K59F-RA 3149..3202 1..54 270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19450343..19451094 1..752 3745 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23564029..23564780 1..752 3760 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23565228..23565979 1..752 3760 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:12:16 has no hits.

IP08069.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:13:13 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19450343..19451094 1..752 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:34:56 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
CG30184-RA 1..672 51..722 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:05 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
CG30184-RA 1..672 51..722 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:36 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
CG30184-RA 1..672 51..722 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:37 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
CG30184-RA 1..672 51..722 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:26:42 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
CG30184-RA 1..672 51..722 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:58 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
CG30184-RA 1..672 51..722 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:05 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
CG30184-RA 1..752 1..752 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:36 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
CG30184-RA 1..752 1..752 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:37 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
CG30184-RA 1..672 51..722 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:26:42 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
CG30184-RA 57..808 1..752 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:13 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23564029..23564780 1..752 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:13 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23564029..23564780 1..752 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:13 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23564029..23564780 1..752 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:36 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19451552..19452303 1..752 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:04 Download gff for IP08069.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23565246..23565997 1..752 100   Plus

IP08069.pep Sequence

Translation from 50 to 721

> IP08069.pep
MQVRSKKPVWFLFKMMELLLSLGCCLVHWTCFMEEGVPHIFLLCGTYGGS
VIICFISLIGAFYAERPTMKHEALFGGILGGLHMVTVYANMYVATLEEFR
TERWPSFYACCRDNAIVALYAGAIYLMHCTFALDLMFSHSRSRANQKMHP
QRSKRPLQLYFISRGAEAYLSRFWFFRRIAARMLTSAQPSEHSGRKRQVS
SSESDSDAKEREEERIRNSEVFK*

IP08069.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13066-PA 228 GF13066-PA 3..218 2..223 638 52.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22868-PA 223 GG22868-PA 1..223 1..223 1022 88.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21210-PA 195 GH21210-PA 1..191 1..191 419 42.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG30184-PA 223 CG30184-PA 1..223 1..223 1183 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20498-PA 209 GI20498-PA 1..202 1..197 400 39.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16872-PA 226 GL16872-PA 1..216 3..206 606 51.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15708-PA 226 GA15708-PA 1..216 3..206 618 52.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16029-PA 223 GM16029-PA 1..223 1..223 1154 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11778-PA 223 GD11778-PA 1..223 1..223 1151 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22349-PA 219 GJ22349-PA 1..190 1..187 395 44.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19222-PA 211 GK19222-PA 1..195 1..190 553 60.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14306-PA 223 GE14306-PA 1..223 1..223 1014 87.4 Plus

IP08069.hyp Sequence

Translation from 50 to 721

> IP08069.hyp
MQVRSKKPVWFLFKMMELLLSLGCCLVHWTCFMEEGVPHIFLLCGTYGGS
VIICFISLIGAFYAERPTMKHEALFGGILGGLHMVTVYANMYVATLEEFR
TERWPSFYACCRDNAIVALYAGAIYLMHCTFALDLMFSHSRSRANQKMHP
QRSKRPLQLYFISRGAEAYLSRFWFFRRIAARMLTSAQPSEHSGRKRQVS
SSESDSDAKEREEERIRNSEVFK*

IP08069.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG30184-PA 223 CG30184-PA 1..223 1..223 1183 100 Plus