Clone IP08076 Report

Search the DGRC for IP08076

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:76
Vector:pOT2
Associated Gene/TranscriptCG31051-RA
Protein status:IP08076.pep: gold
Preliminary Size:654
Sequenced Size:856

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31051 2005-01-01 Successful iPCR screen
CG31051 2008-04-29 Release 5.5 accounting
CG31051 2008-08-15 Release 5.9 accounting
CG31051 2008-12-18 5.12 accounting

Clone Sequence Records

IP08076.complete Sequence

856 bp (856 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022387

> IP08076.complete
TCGTGCAGAGGAAGACAATAAAATTTGTTTGTGTTGTCATCGCGTTTAAC
TCGCTTCTTTAAACATTGTAAAGTTTAATTTTAAAACTATGGAGGATAGC
GGCATCGATAGCGAGGACAGACAATCCAACATCTACGAGGATGGGGCTGC
GGGACTCTTGAAAACGGCCAGCGGAGCACCCAAACATATGTCAGATCTGG
AGTTTGAGGTGGCATTCAGGGGTGCCGGCAAGGTCTATGCCCCCACGACC
ATAGAAATCGATGAAGAGGAGGAAGCGACCGCAGGAAGCGGTCGAGGCCA
CGAGCCACCCAACACCTGCCGCATACTGCAGCGCAAACTGGAGCTGAAGG
TCGAGCGGGCCCGGCGGAACTACACTCAGTTTCAGGCGGAGCAGGCTACC
AAGACGCAGTCGTCCACTCTGATACCAATCAACCGTCTACCCATTCCTGG
CGAGCCGGAACACAAGCCACTGGTGGACTACAAATCCGAGAGTAGCGACG
AGGCCGAGGAGATCTCCTTCTTTCCGGCCCAGCTGAAGCGGTCCAAGCGC
CGCCAGCAGAACCACGAACTGACTGACACCTTCAGCATACAGGAGATGAC
CATTGACTCGGATCTGGAGTCGGACGACAGTGCTGGCACCCAGAACCTCG
AGCTCCTGCTGCCCTCCATGAAGACGACCATTCTGGACAAGTTTAAGGGA
TGCTTCGGATGCTGGCGGCGCAGGTAATGCCAGGCGGAGGAGCGGAGGCA
TATCATCAGGCGGTTCAGGCACAAATCACGTTATTGACAGGCACTAGCAA
CCTACGAACTTAATAATAAACTCCATTGCCACTACAAAAAAAAAAAAAAA
AAAAAA

IP08076.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31051-RA 1026 CG31051-RA 91..928 1..838 4190 100 Plus
CG31051.a 915 CG31051.a 410..856 392..838 2235 100 Plus
CG31051.a 915 CG31051.a 1..394 1..394 1970 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24342532..24342975 835..392 2205 99.8 Minus
chr3R 27901430 chr3R 24343034..24343269 395..160 1150 99.2 Minus
chr3R 27901430 chr3R 24343340..24343499 160..1 785 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28519545..28519991 838..392 2235 100 Minus
3R 32079331 3R 28520050..28520285 395..160 1180 100 Minus
3R 32079331 3R 28520356..28520515 160..1 800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28260376..28260822 838..392 2235 100 Minus
3R 31820162 3R 28260881..28261116 395..160 1180 100 Minus
3R 31820162 3R 28261187..28261346 160..1 800 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:10:11 has no hits.

IP08076.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:11:05 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24342532..24342972 395..835 99 <- Minus
chr3R 24343035..24343268 161..394 99 <- Minus
chr3R 24343340..24343499 1..160 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:02 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
CG31051-RA 1..639 89..727 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:52 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
CG31051-RA 1..639 89..727 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:44:30 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
CG31051-RA 1..639 89..727 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:21 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
CG31051-RA 1..639 89..727 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:12:22 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
CG31051-RA 1..639 89..727 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:30 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
CG31051-RA 1..835 1..835 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:51 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
CG31051-RA 1..835 1..835 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:44:30 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
CG31051-RA 1..835 1..835 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:21 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
CG31051-RA 1..654 74..727 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:12:22 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
CG31051-RA 1..835 1..835 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:05 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28519548..28519988 395..835 100 <- Minus
3R 28520051..28520284 161..394 100 <- Minus
3R 28520356..28520515 1..160 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:05 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28519548..28519988 395..835 100 <- Minus
3R 28520051..28520284 161..394 100 <- Minus
3R 28520356..28520515 1..160 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:05 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28519548..28519988 395..835 100 <- Minus
3R 28520051..28520284 161..394 100 <- Minus
3R 28520356..28520515 1..160 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:44:30 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24345270..24345710 395..835 100 <- Minus
arm_3R 24345773..24346006 161..394 100 <- Minus
arm_3R 24346078..24346237 1..160 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:50 Download gff for IP08076.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28261187..28261346 1..160 100   Minus
3R 28260379..28260819 395..835 100 <- Minus
3R 28260882..28261115 161..394 100 <- Minus

IP08076.hyp Sequence

Translation from 88 to 726

> IP08076.hyp
MEDSGIDSEDRQSNIYEDGAAGLLKTASGAPKHMSDLEFEVAFRGAGKVY
APTTIEIDEEEEATAGSGRGHEPPNTCRILQRKLELKVERARRNYTQFQA
EQATKTQSSTLIPINRLPIPGEPEHKPLVDYKSESSDEAEEISFFPAQLK
RSKRRQQNHELTDTFSIQEMTIDSDLESDDSAGTQNLELLLPSMKTTILD
KFKGCFGCWRRR*

IP08076.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG31051-PA 212 CG31051-PA 1..212 1..212 1095 100 Plus
CG31051-PB 218 CG31051-PB 1..218 1..212 1078 97.2 Plus

IP08076.pep Sequence

Translation from 88 to 726

> IP08076.pep
MEDSGIDSEDRQSNIYEDGAAGLLKTASGAPKHMSDLEFEVAFRGAGKVY
APTTIEIDEEEEATAGSGRGHEPPNTCRILQRKLELKVERARRNYTQFQA
EQATKTQSSTLIPINRLPIPGEPEHKPLVDYKSESSDEAEEISFFPAQLK
RSKRRQQNHELTDTFSIQEMTIDSDLESDDSAGTQNLELLLPSMKTTILD
KFKGCFGCWRRR*

IP08076.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16441-PA 209 GF16441-PA 1..209 1..212 1077 95.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12069-PA 212 GG12069-PA 1..212 1..212 1114 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18721-PA 210 GH18721-PA 1..210 1..212 977 88.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG31051-PA 212 CG31051-PA 1..212 1..212 1095 100 Plus
CG31051-PB 218 CG31051-PB 1..218 1..212 1078 97.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22870-PA 210 GI22870-PA 1..210 1..212 993 89.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23095-PA 212 GL23095-PA 1..212 1..212 982 93.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22194-PA 212 GA22194-PA 1..212 1..212 969 92.5 Plus
Dpse\GA27138-PA 212 GA27138-PA 1..212 1..212 966 92 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16293-PA 216 GM16293-PA 1..216 1..212 970 91.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18033-PA 212 GD18033-PA 1..212 1..212 1119 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14168-PA 210 GJ14168-PA 1..210 1..212 971 87.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11000-PA 209 GK11000-PA 1..209 1..212 975 87.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10513-PA 213 GE10513-PA 1..213 1..212 1106 98.6 Plus