Clone IP08077 Report

Search the DGRC for IP08077

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:77
Vector:pOT2
Associated Gene/TranscriptCG31053-RA
Protein status:IP08077.pep: gold
Preliminary Size:660
Sequenced Size:833

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31053 2005-01-01 Successful iPCR screen
CG31053 2008-04-29 Release 5.5 accounting
CG31053 2008-08-15 Release 5.9 accounting
CG31053 2008-12-18 5.12 accounting

Clone Sequence Records

IP08077.complete Sequence

833 bp (833 high quality bases) assembled on 2006-09-20

GenBank Submission: BT029068

> IP08077.complete
AAACAATTGGTTTTTGGAATGTTTCGAATCCACTGCAACAAATGCTTTCG
ACGCCGCAACGTCGAGCCAACGTTGATCTTCCACATGACCCAGTGCCAAC
ACGTCCTCTGCGCCTCCTGTCTGAGCGAATCCTCGACAGATAAGAAGTGC
CCACTGTGCAAACGGGATCTGCGAGCGATTCCGATCGACAAAAACTTGCC
TCCAAACGTGGCCCAATACTTTGAGGATCCGCTTCGATTCCAGCAGCTCT
ACCGCAAGATCAGCAAGTTCCAGGCCGACCAGCGGGCATCGGACAACCTG
GGATTCTATCGCCAGATGCAGGAGCACGAGAAGAACGAGAGCCGCTTAAA
GGGCTTCTGCAAGATGGAGGCGCAGTTCAACCAGCAGATCCAAAAGGAGA
AGGAACGGATCGCCGAACTTCGCGCCTACATAAAGTACCACGAAGAGGAG
GGTCTCAAGGAGTGGCCACACGCCACGGGGGTTGAGAAGCCCTGGAGCAA
CCAGGCACGTGGCCTGCGGCCCAGGACACCCTCTGTGACCACATCGGATA
ATACCCAGTCGGATGAGCACATGACAACCTTCTGCCTGGACTCGGACATA
GATTGCCTTGAAGAAGACGAACCCCGCCGATACGTCAAGAAAACCTTTAA
CGGAAACATCAAAGATTTTCACATATAATCACTTCTTTCCACAAGTTTTC
CTTAACTACAACTAGATTATTAAGATCATTACAGTGTAAGTAATATTAAA
ATTGGTGCCAGGAGAACTTTAAGCAGAGATCGATGATACCATAACATAAA
TTTAAATCCAGTATCAGCAAAAAAAAAAAAAAA

IP08077.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG31053-RA 820 CG31053-RA 1..820 1..820 4100 100 Plus
nc_19648.a 879 nc_19648.a 303..879 646..70 2885 100 Minus
CG12200-RA 928 CG12200-RA 229..453 207..431 450 80 Plus
CG12200-RA 928 CG12200-RA 100..181 78..159 170 80.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23750315..23751132 818..1 4090 100 Minus
chrX 22417052 chrX 19364004..19364357 78..431 525 76.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27927355..27928174 820..1 4100 100 Minus
X 23542271 X 19475167..19475579 19..431 535 75.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27668186..27669005 820..1 4100 100 Minus
X 23527363 X 19483453..19483677 207..431 450 80 Plus
X 23527363 X 19483324..19483405 78..159 170 80.4 Plus
Blast to na_te.dros performed on 2019-03-16 03:54:35 has no hits.

IP08077.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:55:40 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23750315..23751132 1..818 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:03 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
CG31053-RA 1..660 19..678 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:26:26 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
CG31053-RA 1..660 19..678 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:38 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
CG31053-RA 1..660 19..678 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:46:31 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
CG31053-RA 1..660 19..678 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:19:23 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
CG31053-RA 1..660 19..678 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:54:57 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
CG31053-RA 1..818 1..818 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:26:26 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
CG31053-RA 1..818 1..818 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:38 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
CG31053-RA 1..818 1..818 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:46:32 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
CG31053-RA 1..818 1..818 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:19:23 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
CG31053-RA 1..818 1..818 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:40 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27927357..27928174 1..818 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:40 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27927357..27928174 1..818 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:40 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27927357..27928174 1..818 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:38 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23753079..23753896 1..818 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:53:18 Download gff for IP08077.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27668188..27669005 1..818 100   Minus

IP08077.hyp Sequence

Translation from 0 to 677

> IP08077.hyp
KQLVFGMFRIHCNKCFRRRNVEPTLIFHMTQCQHVLCASCLSESSTDKKC
PLCKRDLRAIPIDKNLPPNVAQYFEDPLRFQQLYRKISKFQADQRASDNL
GFYRQMQEHEKNESRLKGFCKMEAQFNQQIQKEKERIAELRAYIKYHEEE
GLKEWPHATGVEKPWSNQARGLRPRTPSVTTSDNTQSDEHMTTFCLDSDI
DCLEEDEPRRYVKKTFNGNIKDFHI*

IP08077.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31053-PA 219 CG31053-PA 1..219 7..225 1193 100 Plus
CG12200-PA 211 CG12200-PA 1..211 7..225 555 50 Plus

IP08077.pep Sequence

Translation from 18 to 677

> IP08077.pep
MFRIHCNKCFRRRNVEPTLIFHMTQCQHVLCASCLSESSTDKKCPLCKRD
LRAIPIDKNLPPNVAQYFEDPLRFQQLYRKISKFQADQRASDNLGFYRQM
QEHEKNESRLKGFCKMEAQFNQQIQKEKERIAELRAYIKYHEEEGLKEWP
HATGVEKPWSNQARGLRPRTPSVTTSDNTQSDEHMTTFCLDSDIDCLEED
EPRRYVKKTFNGNIKDFHI*

IP08077.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23233-PA 228 GF23233-PA 5..147 1..143 381 47.6 Plus
Dana\GF22805-PA 207 GF22805-PA 1..175 1..188 352 42.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12083-PA 219 GG12083-PA 1..219 1..219 1011 84.9 Plus
Dere\GG19224-PA 209 GG19224-PA 1..209 1..219 576 49.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19167-PA 207 GH19167-PA 1..166 1..172 392 45.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG31053-PA 219 CG31053-PA 1..219 1..219 1193 100 Plus
CG12200-PA 211 CG12200-PA 1..211 1..219 555 50 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23272-PA 230 GI23272-PA 1..177 1..175 317 37.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23882-PA 232 GL23882-PA 1..201 1..195 540 50.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15968-PA 232 GA15968-PA 1..201 1..195 544 50.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16310-PA 218 GM16310-PA 1..218 1..219 1076 91.8 Plus
Dsec\GM24394-PA 218 GM24394-PA 1..218 1..219 1076 91.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18048-PA 219 GD18048-PA 1..219 1..219 1100 92.2 Plus
Dsim\GD24872-PA 211 GD24872-PA 1..211 1..219 602 51.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10772-PA 172 GJ10772-PA 1..114 60..172 219 44 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19085-PA 217 GK19085-PA 1..179 1..185 352 39.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10529-PA 218 GE10529-PA 1..218 1..219 915 80.4 Plus
Dyak\GE15842-PA 209 GE15842-PA 1..209 1..219 605 52.2 Plus