Clone IP08080 Report

Search the DGRC for IP08080

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:80
Vector:pOT2
Associated Gene/TranscriptCG31229-RA
Protein status:IP08080.pep: gold
Preliminary Size:640
Sequenced Size:744

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31229 2005-01-01 Successful iPCR screen
CG31229 2008-04-29 Release 5.5 accounting
CG31229 2008-08-15 Release 5.9 accounting
CG31229 2008-12-18 5.12 accounting

Clone Sequence Records

IP08080.complete Sequence

744 bp (744 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022379

> IP08080.complete
TTTAGCGCAAAACTAAATCCTGCATTTGTGAATAAAAATCTATATAAAAT
AGCAAAGATGTCCGTGCTGCCCAACGCCGGAAACAATGAATCGTCGGTGA
CGGCGCCCAAAATGTTTGGCGATCCGGATTTGGATCGCATGGCGATGGAG
TACGTCGGAAACATGCAGCGCTACCGCGAGAACATCATAATCCCCAAGAG
CAACGGCCCCGTGAAGATCAAGACCAACGAGGAGAAGTTCATCGAAACGG
CGGTGGAGAGCTGTGGATTCAAATGCACCATGGCCTGTGTGATGGGCTAT
GGCTTGGGTGCAGCTTTGGGTTTGTTTAGCGCCTCCGTTAATCCCAACAT
GGCCGATCCGTTCGCGAATGAGAAGAAGCAGACGGCCAGGGAGGTTTTCC
GCGAAATGCGCTCCACCACCCATTCCTACGCGAAGAATTTCGCGCTCATC
GGCTGTGTGTTCTCCGCCGTCGAGTGCACCATCGAGAGCCATCGGGGCGT
CACGGACTGGAAGAATGGCACCTACGCTGGAGGCATCACTGGAGGACTGA
TTGGTTTGCGGGCTGGCGTTAAGGCGGGCATCATCGGCGGCCTGGGATTC
GCCGCCTTCTCCACGGCCATCGACTACTACATGTATTCTAGATAGGCTCA
TATTCTTCGGTTACCTTGTTTCGTAGTAAATGTTTGTTTCTAACTAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP08080.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG31229-RA 915 CG31229-RA 68..764 1..697 3485 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14492073..14492368 1..296 1480 100 Plus
chr3R 27901430 chr3R 14493022..14493227 490..695 1015 99.5 Plus
chr3R 27901430 chr3R 14492758..14492952 295..489 960 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18667928..18668223 1..296 1480 100 Plus
3R 32079331 3R 18668872..18669079 490..697 1040 100 Plus
3R 32079331 3R 18668608..18668802 295..489 975 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18408759..18409054 1..296 1480 100 Plus
3R 31820162 3R 18409703..18409910 490..697 1040 100 Plus
3R 31820162 3R 18409439..18409633 295..489 975 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:00:06 has no hits.

IP08080.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:00:43 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14492073..14492367 1..295 100 -> Plus
chr3R 14492759..14492952 296..489 99 -> Plus
chr3R 14493022..14493227 490..695 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:07 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
CG31229-RA 1..588 58..645 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:33 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
CG31229-RA 1..588 58..645 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:29:08 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
CG31229-RA 1..588 58..645 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:56:11 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
CG31229-RA 1..588 58..645 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:18 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
CG31229-RA 1..588 58..645 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:05:40 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
CG31229-RA 1..640 6..645 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:33 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
CG31229-RA 56..750 1..695 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:29:08 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
CG31229-RA 56..750 1..695 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:56:11 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
CG31229-RA 1..640 6..645 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:18 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
CG31229-RA 77..771 1..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:43 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18667928..18668222 1..295 100 -> Plus
3R 18668609..18668802 296..489 100 -> Plus
3R 18668872..18669077 490..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:43 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18667928..18668222 1..295 100 -> Plus
3R 18668609..18668802 296..489 100 -> Plus
3R 18668872..18669077 490..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:43 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18667928..18668222 1..295 100 -> Plus
3R 18668609..18668802 296..489 100 -> Plus
3R 18668872..18669077 490..695 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:29:08 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14493650..14493944 1..295 100 -> Plus
arm_3R 14494331..14494524 296..489 100 -> Plus
arm_3R 14494594..14494799 490..695 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:31:26 Download gff for IP08080.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18408759..18409053 1..295 100 -> Plus
3R 18409440..18409633 296..489 100 -> Plus
3R 18409703..18409908 490..695 100   Plus

IP08080.pep Sequence

Translation from 0 to 644

> IP08080.pep
FSAKLNPAFVNKNLYKIAKMSVLPNAGNNESSVTAPKMFGDPDLDRMAME
YVGNMQRYRENIIIPKSNGPVKIKTNEEKFIETAVESCGFKCTMACVMGY
GLGAALGLFSASVNPNMADPFANEKKQTAREVFREMRSTTHSYAKNFALI
GCVFSAVECTIESHRGVTDWKNGTYAGGITGGLIGLRAGVKAGIIGGLGF
AAFSTAIDYYMYSR*

IP08080.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16915-PA 195 GF16915-PA 1..195 20..214 877 88.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23025-PA 195 GG23025-PA 1..195 20..214 997 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18354-PA 195 GH18354-PA 1..195 20..214 802 83.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG31229-PA 195 CG31229-PA 1..195 20..214 1021 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23339-PA 195 GI23339-PA 1..195 20..214 777 80 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24360-PA 195 GL24360-PA 1..195 20..214 798 80 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16107-PA 195 GA16107-PA 1..195 20..214 803 80.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17880-PA 195 GM17880-PA 1..195 20..214 1027 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19241-PA 195 GD19241-PA 1..195 20..214 1037 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10338-PA 195 GJ10338-PA 1..195 20..214 799 81.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12207-PA 195 GK12207-PA 1..195 20..214 840 84.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25552-PA 195 GE25552-PA 1..195 20..214 937 94.4 Plus
Dyak\GE25550-PA 195 GE25550-PA 1..195 20..214 937 94.4 Plus

IP08080.hyp Sequence

Translation from 0 to 644

> IP08080.hyp
FSAKLNPAFVNKNLYKIAKMSVLPNAGNNESSVTAPKMFGDPDLDRMAME
YVGNMQRYRENIIIPKSNGPVKIKTNEEKFIETAVESCGFKCTMACVMGY
GLGAALGLFSASVNPNMADPFANEKKQTAREVFREMRSTTHSYAKNFALI
GCVFSAVECTIESHRGVTDWKNGTYAGGITGGLIGLRAGVKAGIIGGLGF
AAFSTAIDYYMYSR*

IP08080.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG31229-PA 195 CG31229-PA 1..195 20..214 1021 100 Plus