BDGP Sequence Production Resources |
Search the DGRC for IP08080
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 80 |
Well: | 80 |
Vector: | pOT2 |
Associated Gene/Transcript | CG31229-RA |
Protein status: | IP08080.pep: gold |
Preliminary Size: | 640 |
Sequenced Size: | 744 |
Gene | Date | Evidence |
---|---|---|
CG31229 | 2005-01-01 | Successful iPCR screen |
CG31229 | 2008-04-29 | Release 5.5 accounting |
CG31229 | 2008-08-15 | Release 5.9 accounting |
CG31229 | 2008-12-18 | 5.12 accounting |
744 bp (744 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022379
> IP08080.complete TTTAGCGCAAAACTAAATCCTGCATTTGTGAATAAAAATCTATATAAAAT AGCAAAGATGTCCGTGCTGCCCAACGCCGGAAACAATGAATCGTCGGTGA CGGCGCCCAAAATGTTTGGCGATCCGGATTTGGATCGCATGGCGATGGAG TACGTCGGAAACATGCAGCGCTACCGCGAGAACATCATAATCCCCAAGAG CAACGGCCCCGTGAAGATCAAGACCAACGAGGAGAAGTTCATCGAAACGG CGGTGGAGAGCTGTGGATTCAAATGCACCATGGCCTGTGTGATGGGCTAT GGCTTGGGTGCAGCTTTGGGTTTGTTTAGCGCCTCCGTTAATCCCAACAT GGCCGATCCGTTCGCGAATGAGAAGAAGCAGACGGCCAGGGAGGTTTTCC GCGAAATGCGCTCCACCACCCATTCCTACGCGAAGAATTTCGCGCTCATC GGCTGTGTGTTCTCCGCCGTCGAGTGCACCATCGAGAGCCATCGGGGCGT CACGGACTGGAAGAATGGCACCTACGCTGGAGGCATCACTGGAGGACTGA TTGGTTTGCGGGCTGGCGTTAAGGCGGGCATCATCGGCGGCCTGGGATTC GCCGCCTTCTCCACGGCCATCGACTACTACATGTATTCTAGATAGGCTCA TATTCTTCGGTTACCTTGTTTCGTAGTAAATGTTTGTTTCTAACTAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31229-RA | 915 | CG31229-RA | 68..764 | 1..697 | 3485 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 14492073..14492368 | 1..296 | 1480 | 100 | Plus |
chr3R | 27901430 | chr3R | 14493022..14493227 | 490..695 | 1015 | 99.5 | Plus |
chr3R | 27901430 | chr3R | 14492758..14492952 | 295..489 | 960 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 18667928..18668223 | 1..296 | 1480 | 100 | Plus |
3R | 32079331 | 3R | 18668872..18669079 | 490..697 | 1040 | 100 | Plus |
3R | 32079331 | 3R | 18668608..18668802 | 295..489 | 975 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 18408759..18409054 | 1..296 | 1480 | 100 | Plus |
3R | 31820162 | 3R | 18409703..18409910 | 490..697 | 1040 | 100 | Plus |
3R | 31820162 | 3R | 18409439..18409633 | 295..489 | 975 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14492073..14492367 | 1..295 | 100 | -> | Plus |
chr3R | 14492759..14492952 | 296..489 | 99 | -> | Plus |
chr3R | 14493022..14493227 | 490..695 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31229-RA | 1..588 | 58..645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31229-RA | 1..588 | 58..645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31229-RA | 1..588 | 58..645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31229-RA | 1..588 | 58..645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31229-RA | 1..588 | 58..645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31229-RA | 1..640 | 6..645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31229-RA | 56..750 | 1..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31229-RA | 56..750 | 1..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31229-RA | 1..640 | 6..645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31229-RA | 77..771 | 1..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18667928..18668222 | 1..295 | 100 | -> | Plus |
3R | 18668609..18668802 | 296..489 | 100 | -> | Plus |
3R | 18668872..18669077 | 490..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18667928..18668222 | 1..295 | 100 | -> | Plus |
3R | 18668609..18668802 | 296..489 | 100 | -> | Plus |
3R | 18668872..18669077 | 490..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18667928..18668222 | 1..295 | 100 | -> | Plus |
3R | 18668609..18668802 | 296..489 | 100 | -> | Plus |
3R | 18668872..18669077 | 490..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14493650..14493944 | 1..295 | 100 | -> | Plus |
arm_3R | 14494331..14494524 | 296..489 | 100 | -> | Plus |
arm_3R | 14494594..14494799 | 490..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18408759..18409053 | 1..295 | 100 | -> | Plus |
3R | 18409440..18409633 | 296..489 | 100 | -> | Plus |
3R | 18409703..18409908 | 490..695 | 100 | Plus |
Translation from 0 to 644
> IP08080.pep FSAKLNPAFVNKNLYKIAKMSVLPNAGNNESSVTAPKMFGDPDLDRMAME YVGNMQRYRENIIIPKSNGPVKIKTNEEKFIETAVESCGFKCTMACVMGY GLGAALGLFSASVNPNMADPFANEKKQTAREVFREMRSTTHSYAKNFALI GCVFSAVECTIESHRGVTDWKNGTYAGGITGGLIGLRAGVKAGIIGGLGF AAFSTAIDYYMYSR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16915-PA | 195 | GF16915-PA | 1..195 | 20..214 | 877 | 88.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23025-PA | 195 | GG23025-PA | 1..195 | 20..214 | 997 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18354-PA | 195 | GH18354-PA | 1..195 | 20..214 | 802 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31229-PA | 195 | CG31229-PA | 1..195 | 20..214 | 1021 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23339-PA | 195 | GI23339-PA | 1..195 | 20..214 | 777 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24360-PA | 195 | GL24360-PA | 1..195 | 20..214 | 798 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16107-PA | 195 | GA16107-PA | 1..195 | 20..214 | 803 | 80.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17880-PA | 195 | GM17880-PA | 1..195 | 20..214 | 1027 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19241-PA | 195 | GD19241-PA | 1..195 | 20..214 | 1037 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10338-PA | 195 | GJ10338-PA | 1..195 | 20..214 | 799 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12207-PA | 195 | GK12207-PA | 1..195 | 20..214 | 840 | 84.1 | Plus |
Translation from 0 to 644
> IP08080.hyp FSAKLNPAFVNKNLYKIAKMSVLPNAGNNESSVTAPKMFGDPDLDRMAME YVGNMQRYRENIIIPKSNGPVKIKTNEEKFIETAVESCGFKCTMACVMGY GLGAALGLFSASVNPNMADPFANEKKQTAREVFREMRSTTHSYAKNFALI GCVFSAVECTIESHRGVTDWKNGTYAGGITGGLIGLRAGVKAGIIGGLGF AAFSTAIDYYMYSR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31229-PA | 195 | CG31229-PA | 1..195 | 20..214 | 1021 | 100 | Plus |