Clone IP08087 Report

Search the DGRC for IP08087

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:87
Vector:pOT2
Associated Gene/TranscriptCG31493-RA
Protein status:IP08087.pep: gold
Preliminary Size:741
Sequenced Size:1015

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31493 2005-01-01 Successful iPCR screen
CG31493 2008-04-29 Release 5.5 accounting
CG31493 2008-08-15 Release 5.9 accounting
CG31493 2008-12-18 5.12 accounting

Clone Sequence Records

IP08087.complete Sequence

1015 bp (1015 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022375

> IP08087.complete
ATTATATTAGCAGTCCGAATAAATTAAACTTTAATCGGGCTAAAAAATTA
AGCGAATACGATTATAGAAATTAATCGTCATTCTTCGTTCGTTTGGAATT
CGGGCGATGAAGGACTGCGTCGAAATTTTCGAAGGGGAGTTTGAGGTCCT
TCGTGTAACTCCACCGCTTTATGATGAAGTTGAAGAGCTGCTTGTGAACA
TTTCGATCAATTATGAGTTCGGATGTGTGATCGCTAAACTTAAAGACTCT
CCGTTGGCCATTGCCGAGCTAGGTAAACTAATAAGGCACATCATATCCCG
AGGAATATCATTCGCTATACGACACGTGGAAAGTGGCAGAATTGTGGCTG
CAATCGCTAATATAATATTTAATACAAAGAGGAAAACCTCATACTACGAC
ATTTGCGCCCAGATCAAGAGTCCAAACATGATAAAGTACATGGAACTTTG
GGATGCTGTCGATGCGAGCTTTAATGTCAACGAGCACTGCCAGGTGGACA
GCACGGGAGATGTGGAATACATGGCCACTTTGCCGGAGTTCAGACGACGT
GGCCTGGGCCACATCTTATGCCAGCAGTCCATCCAGTTCGCAAGTCTCTT
GGCCCAGCGGAAGCTTCCTCTTGAGATACTCAACCAGCTGCCTGAGGAGA
TGCGGATTGAAAGACCGCAGGCCATTGTCGCAATAACTACATCCCAATCC
TCGCAAATAATGGGCAGACAATTGGGAATGAAAACTATGCATAAGTGGCA
TTTTTCCGAGCTGAGGTCCTTGTGCGGAGCGATGGCGGAGTCCAATGGCG
CAGCCCAGGCCTTTGAATATGCAGAACTGCAAGTAGTAAAGTTTTGATGG
AAACCTAACGCGCATTCTGACTAGATTCATAGATTAGTTAGTAAAAGAAG
ATAGTAACGCAAAAGTTCTTAAAAAACGGCATTTAATTTTTATAATTACG
AAAAAGCTCATTCTTATATTATTGGAAATAAAACTAAAATCCAACGAAAA
AAAAAAAAAAAAAAA

IP08087.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG31493-RA 1015 CG31493-RA 16..1014 1..999 4995 100 Plus
CG31493.a 1015 CG31493.a 16..1014 1..999 4995 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2958121..2958753 371..996 2980 98.4 Plus
chr3R 27901430 chr3R 2957620..2957806 1..187 935 100 Plus
chr3R 27901430 chr3R 2957878..2958059 189..370 895 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7132070..7132702 371..1003 3150 99.8 Plus
3R 32079331 3R 7131569..7131755 1..187 935 100 Plus
3R 32079331 3R 7131824..7132008 186..370 925 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6872901..6873533 371..1003 3150 99.8 Plus
3R 31820162 3R 6872400..6872586 1..187 935 100 Plus
3R 31820162 3R 6872655..6872839 186..370 925 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:08:11 has no hits.

IP08087.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:09:23 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2957620..2957806 1..187 100 -> Plus
chr3R 2957877..2958059 188..370 98 -> Plus
chr3R 2958121..2958753 371..996 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:08 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG31493-RA 1..741 107..847 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:53 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG31493-RA 1..741 107..847 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:46:27 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG31493-RA 1..741 107..847 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:22 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG31493-RA 1..741 107..847 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:35:08 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG31493-RA 1..741 107..847 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:32 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG31493-RA 1..741 107..847 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:53 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG31493-RA 10..1005 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:46:27 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG31493-RA 10..1005 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:22 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG31493-RA 1..741 107..847 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:35:08 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG31493-RA 10..1005 1..996 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:23 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7131569..7131755 1..187 100 -> Plus
3R 7131826..7132008 188..370 100 -> Plus
3R 7132070..7132695 371..996 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:23 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7131569..7131755 1..187 100 -> Plus
3R 7131826..7132008 188..370 100 -> Plus
3R 7132070..7132695 371..996 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:23 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7131569..7131755 1..187 100 -> Plus
3R 7131826..7132008 188..370 100 -> Plus
3R 7132070..7132695 371..996 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:46:27 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2957291..2957477 1..187 100 -> Plus
arm_3R 2957548..2957730 188..370 100 -> Plus
arm_3R 2957792..2958417 371..996 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:51 Download gff for IP08087.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6872901..6873526 371..996 100   Plus
3R 6872400..6872586 1..187 100 -> Plus
3R 6872657..6872839 188..370 100 -> Plus

IP08087.hyp Sequence

Translation from 106 to 846

> IP08087.hyp
MKDCVEIFEGEFEVLRVTPPLYDEVEELLVNISINYEFGCVIAKLKDSPL
AIAELGKLIRHIISRGISFAIRHVESGRIVAAIANIIFNTKRKTSYYDIC
AQIKSPNMIKYMELWDAVDASFNVNEHCQVDSTGDVEYMATLPEFRRRGL
GHILCQQSIQFASLLAQRKLPLEILNQLPEEMRIERPQAIVAITTSQSSQ
IMGRQLGMKTMHKWHFSELRSLCGAMAESNGAAQAFEYAELQVVKF*

IP08087.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG31493-PA 246 CG31493-PA 1..246 1..246 1255 100 Plus
CG31493-PB 218 CG31493-PB 1..218 1..246 1051 87 Plus
CG31248-PB 251 CG31248-PB 12..225 7..218 173 26.6 Plus
CG31248-PA 251 CG31248-PA 12..225 7..218 173 26.6 Plus

IP08087.pep Sequence

Translation from 106 to 846

> IP08087.pep
MKDCVEIFEGEFEVLRVTPPLYDEVEELLVNISINYEFGCVIAKLKDSPL
AIAELGKLIRHIISRGISFAIRHVESGRIVAAIANIIFNTKRKTSYYDIC
AQIKSPNMIKYMELWDAVDASFNVNEHCQVDSTGDVEYMATLPEFRRRGL
GHILCQQSIQFASLLAQRKLPLEILNQLPEEMRIERPQAIVAITTSQSSQ
IMGRQLGMKTMHKWHFSELRSLCGAMAESNGAAQAFEYAELQVVKF*

IP08087.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17654-PA 211 GF17654-PA 1..206 1..208 592 52.4 Plus
Dana\GF17653-PA 251 GF17653-PA 12..226 7..219 178 28.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13852-PA 246 GG13852-PA 1..242 1..243 985 76.1 Plus
Dere\GG13841-PA 251 GG13841-PA 12..226 7..219 166 26.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19005-PA 255 GH19005-PA 14..230 9..219 222 30.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG31493-PA 246 CG31493-PA 1..246 1..246 1255 100 Plus
CG31493-PB 218 CG31493-PB 1..218 1..246 1051 87 Plus
CG31248-PB 251 CG31248-PB 12..225 7..218 173 26.6 Plus
CG31248-PA 251 CG31248-PA 12..225 7..218 173 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23060-PA 238 GI23060-PA 47..213 39..219 194 31.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12420-PA 223 GL12420-PA 2..212 3..218 510 44.9 Plus
Dper\GL12419-PA 433 GL12419-PA 194..408 7..219 145 25.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16282-PA 223 GA16282-PA 2..212 3..218 510 44.9 Plus
Dpse\GA16122-PA 251 GA16122-PA 12..226 7..219 150 25.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10935-PA 185 GM10935-PA 28..184 89..245 773 91.7 Plus
Dsec\GM10934-PA 251 GM10934-PA 12..226 7..219 167 26.5 Plus
Dsec\GM10935-PA 185 GM10935-PA 1..27 1..27 142 88.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19914-PA 246 GD19914-PA 1..245 1..245 1225 93.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24572-PA 251 GJ24572-PA 12..226 7..219 200 28.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14520-PA 251 GK14520-PA 15..226 10..219 179 28.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24905-PA 245 GE24905-PA 1..243 1..244 1013 77.5 Plus
Dyak\GE15039-PA 245 GE15039-PA 1..243 1..244 1009 77 Plus
Dyak\GE24904-PA 251 GE24904-PA 12..226 7..219 181 27.4 Plus