Clone IP08088 Report

Search the DGRC for IP08088

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:80
Well:88
Vector:pOT2
Associated Gene/TranscriptCG31600-RA
Protein status:IP08088.pep: gold
Preliminary Size:702
Sequenced Size:986

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31600 2005-01-01 Successful iPCR screen
CG31600 2008-08-15 Release 5.9 accounting
CG31600 2008-12-18 5.12 accounting

Clone Sequence Records

IP08088.complete Sequence

986 bp (971 high quality bases) assembled on 2008-12-09

GenBank Submission: BT022371.2

> IP08088.complete
AGAACTAGTCTCGAGTTTTTTTTTTTTTTTTTGTCAATTTGCGTAGAATA
AAATTGAGCTACGTATATTAAAATAATTCTCAAAATGGTAGAGGGCATGA
TAAAAAAGCTAACTGCTATTTTATTTGGGCTTGTATTGGCTGTGTTATTT
CGAGTAATTATACCCTTTACTCTGCGACTTAAAAGCGCTGAAATAACCAT
TAATGTGCTTAACTGTTTTAATTTTCTAACAAGTACCGTTTCCATTACCA
TTTGCCTGAATTTGGTCAGCCTATACTTAGCCAATTTGCGTGATGATTGG
CTTGTTCTCGGGCTTATACCGCTGCAGATACTCGTCCTTCATTGGACTTA
CTTCACAATTTCAAAACAACTAGAAGCCATGAACAGGAGCTATAGTACAT
TCATGGATAGCTTAAACCTTAAATGGCTGGCATACTCCAATTTTAACGAG
ACAGATTGGCCTTCGATTGAAAATGCGGTTTTATGCTGTGGACTGGAGGG
TCCCCGTTCTTATATGGATTATCTACAAGGGGTTCCAACCCACTGCTACC
ATCCCGACCTTATCACCCAAGGTTGCAGTGACTTTGTTAAAAACATTTTT
ATGCCGATACAACATATAAGTCATTTGCAGCTCAGATTGGCTATTTTTGT
GGAACTGGTAATTTTACTTATTCTTGCTGCAACGCTTTTGAAGAAATGTA
TTTCTTTGATCGGCGAAAGGAAACATAAAAGAGTTATTACACACGGGCTT
GCGGTACTAATAGATTTAGTTAAAAACACATTTTGAAACATTAGCCTTAT
TAACCCTAACCAAATACTACTACTCTATACACTACCATGTAACCATTCTT
GAGTACTAAATGCAGTTTCTTGTAATGTTTGTATTGTTTTAATCTATGCC
ACTGTATTGCATACAATATGTAGATGACAAATCGAAATGGAACAAAGAAA
TAAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP08088.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG31600-RA 952 CG31600-RA 1..932 29..960 4660 100 Plus
CG31600.a 927 CG31600.a 284..917 327..960 3170 100 Plus
CG31600.a 927 CG31600.a 1..284 29..312 1420 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21912796..21913276 957..477 2285 98.3 Minus
chr2L 23010047 chr2L 21913542..21913725 312..129 905 99.5 Minus
chr2L 23010047 chr2L 21913327..21913494 479..312 825 99.4 Minus
chr2L 23010047 chr2L 21913785..21913884 128..29 500 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21914266..21914749 960..477 2420 100 Minus
2L 23513712 2L 21915016..21915199 312..129 920 100 Minus
2L 23513712 2L 21914800..21914967 479..312 840 100 Minus
2L 23513712 2L 21915258..21915358 129..29 505 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21914266..21914749 960..477 2420 100 Minus
2L 23513712 2L 21915016..21915199 312..129 920 100 Minus
2L 23513712 2L 21914800..21914967 479..312 840 100 Minus
2L 23513712 2L 21915258..21915358 129..29 505 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:51:09 has no hits.

IP08088.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:51:45 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21912796..21913275 478..957 98 <- Minus
chr2L 21913329..21913493 313..477 99 <- Minus
chr2L 21913542..21913724 130..312 99 <- Minus
chr2L 21913784..21913886 27..129 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:03:45 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG31600-RA 1..702 85..786 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:36 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG31600-RA 1..702 85..786 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:11:06 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG31600-RA 1..702 85..786 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:23 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG4793-RC 2570..2589 462..481 95   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:20:26 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG31600-RA 1..702 85..786 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-09 11:32:38 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG31600-RA 1..702 85..786 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:36 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG31600-RA 1..929 29..957 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:11:06 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG31600-RA 1..929 29..957 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:24 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG31600-RA 1..702 201..902 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:26 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG31600-RA 1..929 29..957 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:45 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21914269..21914748 478..957 100 <- Minus
2L 21914802..21914966 313..477 100 <- Minus
2L 21915016..21915198 130..312 100 <- Minus
2L 21915258..21915360 27..129 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:45 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21914269..21914748 478..957 100 <- Minus
2L 21914802..21914966 313..477 100 <- Minus
2L 21915016..21915198 130..312 100 <- Minus
2L 21915258..21915360 27..129 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:45 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21914269..21914748 478..957 100 <- Minus
2L 21914802..21914966 313..477 100 <- Minus
2L 21915016..21915198 130..312 100 <- Minus
2L 21915258..21915360 27..129 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:11:06 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21914269..21914748 478..957 100 <- Minus
arm_2L 21914802..21914966 313..477 100 <- Minus
arm_2L 21915016..21915198 130..312 100 <- Minus
arm_2L 21915258..21915360 27..129 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:14 Download gff for IP08088.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21915258..21915360 27..129 99 <- Minus
2L 21914269..21914748 478..957 100 <- Minus
2L 21914802..21914966 313..477 100 <- Minus
2L 21915016..21915198 130..312 100 <- Minus

IP08088.hyp Sequence

Translation from 84 to 785

> IP08088.hyp
MVEGMIKKLTAILFGLVLAVLFRVIIPFTLRLKSAEITINVLNCFNFLTS
TVSITICLNLVSLYLANLRDDWLVLGLIPLQILVLHWTYFTISKQLEAMN
RSYSTFMDSLNLKWLAYSNFNETDWPSIENAVLCCGLEGPRSYMDYLQGV
PTHCYHPDLITQGCSDFVKNIFMPIQHISHLQLRLAIFVELVILLILAAT
LLKKCISLIGERKHKRVITHGLAVLIDLVKNTF*

IP08088.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG31600-PA 233 CG31600-PA 1..233 1..233 1201 100 Plus
CG31600-PB 228 CG31600-PB 1..228 1..233 1161 97.9 Plus

IP08088.pep Sequence

Translation from 84 to 785

> IP08088.pep
MVEGMIKKLTAILFGLVLAVLFRVIIPFTLRLKSAEITINVLNCFNFLTS
TVSITICLNLVSLYLANLRDDWLVLGLIPLQILVLHWTYFTISKQLEAMN
RSYSTFMDSLNLKWLAYSNFNETDWPSIENAVLCCGLEGPRSYMDYLQGV
PTHCYHPDLITQGCSDFVKNIFMPIQHISHLQLRLAIFVELVILLILAAT
LLKKCISLIGERKHKRVITHGLAVLIDLVKNTF*

IP08088.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20039-PA 212 GF20039-PA 1..207 16..216 332 30.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21473-PA 229 GG21473-PA 1..229 1..233 833 68.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31600-PA 233 CG31600-PA 1..233 1..233 1201 100 Plus
CG31600-PB 228 CG31600-PB 1..228 1..233 1161 97.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24541-PA 207 GI24541-PA 1..195 1..191 203 29 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26120-PA 236 GL26120-PA 25..226 14..213 307 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16332-PB 236 GA16332-PB 25..226 14..213 303 36.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16124-PA 233 GM16124-PA 1..233 1..233 1096 93.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21625-PA 233 GD21625-PA 1..233 1..233 1078 92.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17153-PA 175 GJ17153-PA 2..149 78..224 187 31.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12975-PA 233 GE12975-PA 1..233 1..233 861 71.2 Plus