BDGP Sequence Production Resources |
Search the DGRC for IP08114
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 81 |
Well: | 14 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15425-RA |
Protein status: | IP08114.pep: gold |
Preliminary Size: | 697 |
Sequenced Size: | 811 |
Gene | Date | Evidence |
---|---|---|
CG15425 | 2005-01-01 | Successful iPCR screen |
CG15425 | 2008-04-29 | Release 5.5 accounting |
CG15425 | 2008-08-15 | Release 5.9 accounting |
CG15425 | 2008-12-18 | 5.12 accounting |
811 bp (811 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022355
> IP08114.complete TTTAGCAAACATTTGGTATTAGGAAAAATCAACTTGTGATAAAACAAAAT TCATTTAAAAATAATCACATAGACCATTATGAATTCCACACGGCGAGCTC GTGCCAAAATTGTGACCAAGAAAAAGATTACTGGCCGTAAAGTGCCCAGA ACAGATCCGCAGCAGCAGTTTTACTTAAAAAACAGATTCAATGCAACTCG TCCTCGTCCAAAACAATCAACCGTGCCTCCTAGCCAGCGAATCTGGCGCA GGACAGTGGTCCAGACCAAGCCGAAAATAAAAACAAAGATCCCCAGGCTA TTTCGCATGGATCGGAATACAGGACTTCCGGTGGATTACGAGAGGACGGT CAACCAGGTGATGCAGTACGTGAATCCCAATTTGCGCAATCCACCCAGCG CGGAAAAGGTTTTGGAGGAATTGCTGACGAAAATGCTTACTGAGGTCGTA CGACAGGGTGGTCGGTGTTGTCGAGAACACTCTCAATTGAGATCCTTGCT GAAGAACAGGTGCCACTGCCACAGGTCGAGCCAGTTCCTAAGCAAGGCAG AGAAGGCCAGGTTCGAGGCGAACGAGAGTCTGAGCCAATTTCATAGTGCT TGCAAACGGGGACCCTGTCGAATCCCCAGTACCAAACTTGGTCCCACGTA CATGAGTAAGTTCAACTTTAACCAGCTGAAAATCAAGAGCTCATAAAAAA AAGGTGGAAACCACCATGTCAAACTGTTTAATACTATAAGAAGGTCAATT GATTCAGTTGTAAATTTGGAATAAATATTTTTGACTTTTTTATGGAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15425-RA | 877 | CG15425-RA | 32..828 | 1..797 | 3985 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 4256755..4257356 | 1..602 | 100 | -> | Plus |
chr2L | 4257416..4257608 | 603..795 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15425-RA | 1..618 | 79..696 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15425-RA | 1..618 | 79..696 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15425-RA | 1..618 | 79..696 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15425-RA | 1..618 | 79..696 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15425-RA | 1..618 | 79..696 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15425-RA | 2..697 | 1..696 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15425-RA | 1..795 | 1..795 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15425-RA | 1..795 | 1..795 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15425-RA | 2..697 | 1..696 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15425-RA | 1..795 | 1..795 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4257572..4258173 | 1..602 | 100 | -> | Plus |
2L | 4258233..4258425 | 603..795 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4257572..4258173 | 1..602 | 100 | -> | Plus |
2L | 4258233..4258425 | 603..795 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4257572..4258173 | 1..602 | 100 | -> | Plus |
2L | 4258233..4258425 | 603..795 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 4257572..4258173 | 1..602 | 100 | -> | Plus |
arm_2L | 4258233..4258425 | 603..795 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4257572..4258173 | 1..602 | 100 | -> | Plus |
2L | 4258233..4258425 | 603..795 | 100 | Plus |
Translation from 78 to 695
> IP08114.pep MNSTRRARAKIVTKKKITGRKVPRTDPQQQFYLKNRFNATRPRPKQSTVP PSQRIWRRTVVQTKPKIKTKIPRLFRMDRNTGLPVDYERTVNQVMQYVNP NLRNPPSAEKVLEELLTKMLTEVVRQGGRCCREHSQLRSLLKNRCHCHRS SQFLSKAEKARFEANESLSQFHSACKRGPCRIPSTKLGPTYMSKFNFNQL KIKSS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15017-PA | 222 | GF15017-PA | 13..222 | 6..205 | 487 | 52.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24989-PA | 205 | GG24989-PA | 1..205 | 1..205 | 818 | 76.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10065-PA | 190 | GH10065-PA | 31..189 | 34..204 | 286 | 43.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15425-PA | 205 | CG15425-PA | 1..205 | 1..205 | 1076 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16503-PA | 189 | GI16503-PA | 41..189 | 53..205 | 319 | 44.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14000-PA | 170 | GL14000-PA | 47..170 | 42..205 | 311 | 42.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13717-PA | 234 | GA13717-PA | 56..234 | 40..205 | 362 | 46.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18460-PA | 205 | GM18460-PA | 1..205 | 1..205 | 1032 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23273-PA | 205 | GD23273-PA | 1..205 | 1..205 | 1039 | 95.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16221-PA | 206 | GJ16221-PA | 41..205 | 28..204 | 336 | 42.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24610-PA | 169 | GK24610-PA | 40..166 | 51..174 | 212 | 40 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18277-PA | 206 | GE18277-PA | 1..206 | 1..205 | 845 | 80.1 | Plus |
Translation from 78 to 695
> IP08114.hyp MNSTRRARAKIVTKKKITGRKVPRTDPQQQFYLKNRFNATRPRPKQSTVP PSQRIWRRTVVQTKPKIKTKIPRLFRMDRNTGLPVDYERTVNQVMQYVNP NLRNPPSAEKVLEELLTKMLTEVVRQGGRCCREHSQLRSLLKNRCHCHRS SQFLSKAEKARFEANESLSQFHSACKRGPCRIPSTKLGPTYMSKFNFNQL KIKSS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15425-PA | 205 | CG15425-PA | 1..205 | 1..205 | 1076 | 100 | Plus |