Clone IP08115 Report

Search the DGRC for IP08115

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:81
Well:15
Vector:pOT2
Associated Gene/TranscriptCG15535-RA
Protein status:IP08115.pep: gold
Preliminary Size:733
Sequenced Size:760

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15535 2005-01-01 Successful iPCR screen
CG15535 2008-04-29 Release 5.5 accounting
CG15535 2008-08-15 Release 5.9 accounting
CG15535 2008-12-18 5.12 accounting

Clone Sequence Records

IP08115.complete Sequence

760 bp (760 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022235

> IP08115.complete
AAAACACAAAAATGAAACCGAGATCGCAAAAAAGCCAAGGAAAACCCAAT
GGAAAACCAAACAGAGGCGCTGGTAAGGTGGGCCACAACCAGAAACCCTA
CTTCAAGAACAAGAACAACCAAAAGGCCAAAGGGGAAAAGCCAAATAAAC
CGGAAATTCGGAACATGAAACGCAAGGAAAAGGCTGCCCAGGAGGCTGCG
GAGCGGGAGAAAGTTAGAGCGGACCGGGATGCCCAGGTGAAGGCCTATAA
AAAGAAACGTTTGGAGAAAACCAAGGCCATCAGCAAAAGGACCCAAAAGG
GACAGCCCTTGATGAAGGATCGCATGCAGCTCTTACTGAAGCAGATCGAG
GAGATGAAACGCAACTAAGTGAGTCGCAGGACCTCTATGCTACACTAGGA
ACACTTCCCCAGCCTCACAATCAGTTGTTCATCTACACATACATATATGT
AGTGTACATAAAAACGTTTACTTTTAGAGTAGGGTTACTTTAATTTTAAT
TTAACAAATTGTTTTTCACAATTATATTCTTATAAAAAATGTTACCTAAC
CATGTTTTTCTATGGTCTTCCAATGGATTTCTTATTTATGTATTATAAGT
ACTTAAATTTACTTTTTTATAAATAAGTTTTCTGTATTATTGATTTTTGT
GCACTTATTTATTTTTAAATTCTTAAAACCCATTAACTATAAATCGTTTT
AACTGTTACAAGCCAATAATACAATTTGAAACAAATGCTCCCAAAAAAAA
AAAAAAAAAA

IP08115.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15535-RA 836 CG15535-RA 73..815 1..743 3715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26245583..26246191 742..134 2985 99.3 Minus
chr3R 27901430 chr3R 26246260..26246394 135..1 675 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30423031..30423640 743..134 3050 100 Minus
3R 32079331 3R 30423709..30423843 135..1 675 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30163862..30164471 743..134 3050 100 Minus
3R 31820162 3R 30164540..30164674 135..1 675 100 Minus
Blast to na_te.dros performed 2019-03-15 19:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1137..1296 609..453 144 59.8 Minus
Stalker2 7672 Stalker2 STALKER2 7672bp 7088..7309 666..447 122 53.6 Minus

IP08115.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:12:39 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26245583..26246190 135..742 99 <- Minus
chr3R 26246261..26246394 1..134 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:26 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
CG15535-RA 1..357 12..368 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:58 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
CG15535-RA 1..357 12..368 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:45:31 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
CG15535-RA 1..357 12..368 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:27 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
CG15535-RA 1..357 12..368 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:13:18 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
CG15535-RA 1..357 12..368 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:44 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
CG15535-RA 1..731 12..742 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:58 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
CG15535-RA 1..742 1..742 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:45:31 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
CG15535-RA 1..571 1..571 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:28 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
CG15535-RA 1..731 12..742 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:13:18 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
CG15535-RB 87..828 1..742 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:39 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30423032..30423639 135..742 100 <- Minus
3R 30423710..30423843 1..134 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:39 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30423032..30423639 135..742 100 <- Minus
3R 30423710..30423843 1..134 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:39 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30423032..30423639 135..742 100 <- Minus
3R 30423710..30423843 1..134 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:45:31 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26248754..26249361 135..742 100 <- Minus
arm_3R 26249432..26249565 1..134 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:57 Download gff for IP08115.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30163863..30164470 135..742 100 <- Minus
3R 30164541..30164674 1..134 100   Minus

IP08115.hyp Sequence

Translation from 2 to 367

> IP08115.hyp
NTKMKPRSQKSQGKPNGKPNRGAGKVGHNQKPYFKNKNNQKAKGEKPNKP
EIRNMKRKEKAAQEAAEREKVRADRDAQVKAYKKKRLEKTKAISKRTQKG
QPLMKDRMQLLLKQIEEMKRN*

IP08115.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15535-PB 118 CG15535-PB 1..118 4..121 607 100 Plus
CG15535-PA 118 CG15535-PA 1..118 4..121 607 100 Plus

IP08115.pep Sequence

Translation from 2 to 367

> IP08115.pep
NTKMKPRSQKSQGKPNGKPNRGAGKVGHNQKPYFKNKNNQKAKGEKPNKP
EIRNMKRKEKAAQEAAEREKVRADRDAQVKAYKKKRLEKTKAISKRTQKG
QPLMKDRMQLLLKQIEEMKRN*

IP08115.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16184-PA 96 GF16184-PA 1..95 26..120 347 71.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11940-PA 118 GG11940-PA 1..118 4..121 529 89.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18414-PA 118 GH18414-PA 1..118 4..121 312 58.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG15535-PB 118 CG15535-PB 1..118 4..121 607 100 Plus
CG15535-PA 118 CG15535-PA 1..118 4..121 607 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24317-PA 113 GI24317-PA 1..111 4..120 295 67.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14053-PA 118 GL14053-PA 1..116 4..119 378 66.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13793-PA 118 GA13793-PA 1..116 4..119 381 67.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12160-PA 118 GM12160-PA 1..118 4..121 569 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17123-PA 118 GD17123-PA 1..118 4..121 572 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10400-PA 115 GJ10400-PA 1..112 4..119 322 64.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13133-PA 120 GK13133-PA 1..118 4..119 304 57.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23392-PA 118 GE23392-PA 1..118 4..121 553 94.1 Plus