Clone IP08122 Report

Search the DGRC for IP08122

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:81
Well:22
Vector:pOT2
Associated Gene/TranscriptCG15711-RA
Protein status:IP08122.pep: gold
Preliminary Size:664
Sequenced Size:744

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15711 2005-01-01 Successful iPCR screen
CG15711 2008-04-29 Release 5.5 accounting
CG15711 2008-08-15 Release 5.9 accounting
CG15711 2008-12-18 5.12 accounting

Clone Sequence Records

IP08122.complete Sequence

744 bp (744 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022239

> IP08122.complete
ACACAAACCCGTCGACTTCGAAATTCAAAATTTGACCCCGGATTTGTTGA
CTCGGTGATCCTTGAATCGATGATCATGTTGGAGGCCACCTTGCAGCCAG
GATATGTGCCTGTTGGCATCACGCCAATCTTGAATTGGACAGAGCCACCA
AGTCTAAAGCATTGTGATGAGGATTATCTGATCGTTGTCCTGGCATTGTC
CATTTGCACCCAGTTCTTGCTGATGACCTATGTGGCGTTCGCAGTCATGC
AACCGTGTTCCATGCGAAGGAAGCAGTTGATTGAGGGCCAGCAAAAGACC
TTCGCTAGCTTCATATTCCGAAGGTTACTCTTCCAGTTGGACGAGGCATT
ACACCCTTCGGTCGAGGCGGTGCGGTTAGACTCCTGCTTGAGGTCTGGTG
AAAAGCTAATCCAGGCCATTCAACTGTTCCGGCGAGATGCTCTCAAGGTC
CTTCAGCCAGTGCAGAATATCTCATCCGCAATGGCCAGCGATTTGTACTA
TGTGCTGGACGAGGAGGAGAATGAACTGAATTTCAACGGCTATGGGAGCT
CTCATTCAAAGGTCGAGGTCACCGAGGAACTATTGGTGTATTTGCTATAT
CCGGAACGAAAAGTGTCCGAGAAGAAGTAATACGTCGGACTGGGGAACCT
AAATTTTTGGCTCTACTTGATTTGTATTTTTGTATAAACTTTCCGCAAAG
TCCACTAAATTCACGAATTAAGTAAAAAAAAAAAAAAAAAAAAA

IP08122.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15711-RA 757 CG15711-RA 35..757 1..723 3615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12250870..12251592 723..1 3555 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16363549..16364273 725..1 3625 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16364748..16365472 725..1 3625 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:48:25 has no hits.

IP08122.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:49:25 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12250870..12251592 1..723 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:27 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
CG15711-RA 1..561 70..630 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:00:06 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
CG15711-RA 1..561 70..630 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:00:33 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
CG15711-RA 1..561 70..630 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:40:39 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
CG15711-RA 1..561 70..630 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:23:43 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
CG15711-RA 1..561 70..630 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:42:36 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
CG15711-RA 35..664 1..630 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:00:06 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
CG15711-RA 35..757 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:00:33 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
CG15711-RA 35..757 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:40:39 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
CG15711-RA 35..664 1..630 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:23:43 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
CG15711-RA 35..757 1..723 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:49:25 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16363551..16364273 1..723 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:49:25 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16363551..16364273 1..723 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:49:25 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16363551..16364273 1..723 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:00:33 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12251056..12251778 1..723 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:19:35 Download gff for IP08122.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16364750..16365472 1..723 100   Minus

IP08122.hyp Sequence

Translation from 0 to 629

> IP08122.hyp
TQTRRLRNSKFDPGFVDSVILESMIMLEATLQPGYVPVGITPILNWTEPP
SLKHCDEDYLIVVLALSICTQFLLMTYVAFAVMQPCSMRRKQLIEGQQKT
FASFIFRRLLFQLDEALHPSVEAVRLDSCLRSGEKLIQAIQLFRRDALKV
LQPVQNISSAMASDLYYVLDEEENELNFNGYGSSHSKVEVTEELLVYLLY
PERKVSEKK*

IP08122.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG15711-PB 186 CG15711-PB 1..186 24..209 944 100 Plus
CG15711-PA 186 CG15711-PA 1..186 24..209 944 100 Plus

IP08122.pep Sequence

Translation from 0 to 629

> IP08122.pep
TQTRRLRNSKFDPGFVDSVILESMIMLEATLQPGYVPVGITPILNWTEPP
SLKHCDEDYLIVVLALSICTQFLLMTYVAFAVMQPCSMRRKQLIEGQQKT
FASFIFRRLLFQLDEALHPSVEAVRLDSCLRSGEKLIQAIQLFRRDALKV
LQPVQNISSAMASDLYYVLDEEENELNFNGYGSSHSKVEVTEELLVYLLY
PERKVSEKK*

IP08122.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21995-PA 250 GF21995-PA 36..245 20..205 430 48.8 Plus
Dana\GF24305-PA 228 GF24305-PA 65..212 61..201 161 36.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22269-PA 184 GG22269-PA 1..184 26..209 785 80.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24265-PA 195 GH24265-PA 31..184 43..203 256 39.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15711-PB 186 CG15711-PB 1..186 24..209 944 100 Plus
CG15711-PA 186 CG15711-PA 1..186 24..209 944 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15947-PA 181 GI15947-PA 25..170 57..203 279 43.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16642-PA 77 GL16642-PA 3..67 137..203 150 47.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22874-PA 77 GA22874-PA 3..67 137..203 156 49.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20058-PA 184 GM20058-PA 1..184 26..209 843 87 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25540-PA 184 GD25540-PA 1..184 26..209 843 86.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14853-PA 181 GJ14853-PA 39..170 71..203 268 46.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24996-PA 164 GK24996-PA 1..159 44..203 337 42.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14062-PA 184 GE14062-PA 1..184 26..209 757 78.3 Plus