BDGP Sequence Production Resources |
Search the DGRC for IP08122
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 81 |
Well: | 22 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15711-RA |
Protein status: | IP08122.pep: gold |
Preliminary Size: | 664 |
Sequenced Size: | 744 |
Gene | Date | Evidence |
---|---|---|
CG15711 | 2005-01-01 | Successful iPCR screen |
CG15711 | 2008-04-29 | Release 5.5 accounting |
CG15711 | 2008-08-15 | Release 5.9 accounting |
CG15711 | 2008-12-18 | 5.12 accounting |
744 bp (744 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022239
> IP08122.complete ACACAAACCCGTCGACTTCGAAATTCAAAATTTGACCCCGGATTTGTTGA CTCGGTGATCCTTGAATCGATGATCATGTTGGAGGCCACCTTGCAGCCAG GATATGTGCCTGTTGGCATCACGCCAATCTTGAATTGGACAGAGCCACCA AGTCTAAAGCATTGTGATGAGGATTATCTGATCGTTGTCCTGGCATTGTC CATTTGCACCCAGTTCTTGCTGATGACCTATGTGGCGTTCGCAGTCATGC AACCGTGTTCCATGCGAAGGAAGCAGTTGATTGAGGGCCAGCAAAAGACC TTCGCTAGCTTCATATTCCGAAGGTTACTCTTCCAGTTGGACGAGGCATT ACACCCTTCGGTCGAGGCGGTGCGGTTAGACTCCTGCTTGAGGTCTGGTG AAAAGCTAATCCAGGCCATTCAACTGTTCCGGCGAGATGCTCTCAAGGTC CTTCAGCCAGTGCAGAATATCTCATCCGCAATGGCCAGCGATTTGTACTA TGTGCTGGACGAGGAGGAGAATGAACTGAATTTCAACGGCTATGGGAGCT CTCATTCAAAGGTCGAGGTCACCGAGGAACTATTGGTGTATTTGCTATAT CCGGAACGAAAAGTGTCCGAGAAGAAGTAATACGTCGGACTGGGGAACCT AAATTTTTGGCTCTACTTGATTTGTATTTTTGTATAAACTTTCCGCAAAG TCCACTAAATTCACGAATTAAGTAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15711-RA | 757 | CG15711-RA | 35..757 | 1..723 | 3615 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 12250870..12251592 | 723..1 | 3555 | 99.4 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 16363549..16364273 | 725..1 | 3625 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 16364748..16365472 | 725..1 | 3625 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 12250870..12251592 | 1..723 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15711-RA | 1..561 | 70..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15711-RA | 1..561 | 70..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15711-RA | 1..561 | 70..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15711-RA | 1..561 | 70..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15711-RA | 1..561 | 70..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15711-RA | 35..664 | 1..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15711-RA | 35..757 | 1..723 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15711-RA | 35..757 | 1..723 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15711-RA | 35..664 | 1..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15711-RA | 35..757 | 1..723 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16363551..16364273 | 1..723 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16363551..16364273 | 1..723 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16363551..16364273 | 1..723 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 12251056..12251778 | 1..723 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16364750..16365472 | 1..723 | 100 | Minus |
Translation from 0 to 629
> IP08122.hyp TQTRRLRNSKFDPGFVDSVILESMIMLEATLQPGYVPVGITPILNWTEPP SLKHCDEDYLIVVLALSICTQFLLMTYVAFAVMQPCSMRRKQLIEGQQKT FASFIFRRLLFQLDEALHPSVEAVRLDSCLRSGEKLIQAIQLFRRDALKV LQPVQNISSAMASDLYYVLDEEENELNFNGYGSSHSKVEVTEELLVYLLY PERKVSEKK*
Translation from 0 to 629
> IP08122.pep TQTRRLRNSKFDPGFVDSVILESMIMLEATLQPGYVPVGITPILNWTEPP SLKHCDEDYLIVVLALSICTQFLLMTYVAFAVMQPCSMRRKQLIEGQQKT FASFIFRRLLFQLDEALHPSVEAVRLDSCLRSGEKLIQAIQLFRRDALKV LQPVQNISSAMASDLYYVLDEEENELNFNGYGSSHSKVEVTEELLVYLLY PERKVSEKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21995-PA | 250 | GF21995-PA | 36..245 | 20..205 | 430 | 48.8 | Plus |
Dana\GF24305-PA | 228 | GF24305-PA | 65..212 | 61..201 | 161 | 36.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22269-PA | 184 | GG22269-PA | 1..184 | 26..209 | 785 | 80.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24265-PA | 195 | GH24265-PA | 31..184 | 43..203 | 256 | 39.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15711-PB | 186 | CG15711-PB | 1..186 | 24..209 | 944 | 100 | Plus |
CG15711-PA | 186 | CG15711-PA | 1..186 | 24..209 | 944 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15947-PA | 181 | GI15947-PA | 25..170 | 57..203 | 279 | 43.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16642-PA | 77 | GL16642-PA | 3..67 | 137..203 | 150 | 47.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22874-PA | 77 | GA22874-PA | 3..67 | 137..203 | 156 | 49.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20058-PA | 184 | GM20058-PA | 1..184 | 26..209 | 843 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25540-PA | 184 | GD25540-PA | 1..184 | 26..209 | 843 | 86.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14853-PA | 181 | GJ14853-PA | 39..170 | 71..203 | 268 | 46.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24996-PA | 164 | GK24996-PA | 1..159 | 44..203 | 337 | 42.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14062-PA | 184 | GE14062-PA | 1..184 | 26..209 | 757 | 78.3 | Plus |