Clone IP08144 Report

Search the DGRC for IP08144

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:81
Well:44
Vector:pOT2
Associated Gene/TranscriptCG17601-RA
Protein status:IP08144.pep: gold
Preliminary Size:663
Sequenced Size:1003

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17601 2005-01-01 Successful iPCR screen
CG17601 2008-04-29 Release 5.5 accounting
CG17601 2008-08-15 Release 5.9 accounting
CG17601 2008-12-18 5.12 accounting

Clone Sequence Records

IP08144.complete Sequence

1003 bp (1003 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022255

> IP08144.complete
CAGAGACGTTTGCATATAGTCATAACCACAGCTATGGCCCCAAGGAAACG
GATCTCGAGGATTGCATCACGCAGTGTGGCGACTGTGGAGCAGTTCACTA
AGCGCATCAACTGCCGCTCGGTTGGCACCCAAACCGATATCCTGGCTAAG
GGTCCGGCGAAGCGCAAAAAGGTCGAGAACAAGGTCAAGCTGCTGGATTC
GCAGCCACTGTCGTCCCAGTACTTGGCCATCCATCTGATGCCGGCAATCA
ATCCACTGGCAACTGAAACAATAAATCGGCGTCCGGATACATTCTCATAT
TTTCTCCCCGGTCCAAATGAGAAGTCTTGCCAGGCTGTGGCCGACCGAAT
CGCTGACGCAAGCGATCGGGTCATCACCGCTAGCTCCGGAGAACGGCAAA
TAAACCACCTGAAGTCTGTGGTGAGCAACCGCCGCGAAGAGGCCAACCAG
TGGGATCGTAACCGTCTTGAAATTCTGCTGGCCCAGATCAATGGTGACCC
GCCGCCGCGCTGGAACTCGGCCACCCAATTGTGGCTAGAGGTTGACATGC
TGGAGAAGCGCATAGAGGCCTACGACCAAGAAGAACTGCAGAATGCCAAG
AATCGCAATTTGGACAGGAAGCTAGACGGTGGGCAGGATAAGGGGCCGTC
AGATGAAAAGGACCAGCAGACTTTGAAGACTTTGAAGGCAACGTAGCCTT
TTCATATTTAATATTCAATGGCTAATAATGGTGGTCTATAAAGTCGAACT
CGACTTGGATTTATACACATTGCATTCATTTGTACACACAAAAAATGGAT
TCGTTTAAATACTTAGACGATTCATTTTTTAATTATGACAACTGAATATG
AATATGATATGATCAATATGATGAAATATTGATTTGCAATCATTGCCGTG
GAAAATGGTAATCTTAAAGCAAATAAATCAGCAAAAATATGTGGATTTAT
GAATTACCGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

IP08144.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG17601-RA 960 CG17601-RA 1..960 1..960 4800 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 21943063..21944022 1..960 4800 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:54:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 22547097..22548061 1..965 4825 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 22532189..22533153 1..965 4825 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:46:31 has no hits.

IP08144.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:47:35 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 21943063..21944022 1..960 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:34 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17601-RA 1..663 34..696 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:45 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17601-RA 1..663 34..696 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:06 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17601-RA 1..663 34..696 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:13 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17601-RA 1..663 34..696 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:42:00 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17601-RA 1..663 34..696 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:15 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17601-RA 1..960 1..960 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:45 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17601-RA 1..960 1..960 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:06 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17601-RA 1..960 1..960 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:13 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17601-RA 1..960 1..960 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:42:00 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17601-RA 1..960 1..960 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:47:35 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
X 22547097..22548056 1..960 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:47:35 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
X 22547097..22548056 1..960 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:47:35 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
X 22547097..22548056 1..960 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:06 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21948933..21949892 1..960 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:44 Download gff for IP08144.complete
Subject Subject Range Query Range Percent Splice Strand
X 22532189..22533148 1..960 100   Plus

IP08144.pep Sequence

Translation from 0 to 695

> IP08144.pep
QRRLHIVITTAMAPRKRISRIASRSVATVEQFTKRINCRSVGTQTDILAK
GPAKRKKVENKVKLLDSQPLSSQYLAIHLMPAINPLATETINRRPDTFSY
FLPGPNEKSCQAVADRIADASDRVITASSGERQINHLKSVVSNRREEANQ
WDRNRLEILLAQINGDPPPRWNSATQLWLEVDMLEKRIEAYDQEELQNAK
NRNLDRKLDGGQDKGPSDEKDQQTLKTLKAT*

IP08144.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21006-PA 205 GF21006-PA 1..186 12..195 351 43.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19752-PA 238 GG19752-PA 1..204 12..215 631 60.8 Plus
Dere\GG10912-PA 382 GG10912-PA 1..217 12..226 631 59.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13697-PA 255 GH13697-PA 191..253 138..202 154 47.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG17601-PA 220 CG17601-PA 1..220 12..231 1124 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15641-PA 205 GI15641-PA 123..202 108..195 159 37.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16548-PA 191 GL16548-PA 1..187 12..198 142 30.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11738-PA 217 GM11738-PA 1..214 12..231 954 84.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24891-PA 212 GD24891-PA 11..209 27..231 813 77.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19228-PA 166 GJ19228-PA 98..162 129..193 166 49.2 Plus
Dvir\GJ21091-PA 171 GJ21091-PA 102..163 134..195 165 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19834-PA 188 GK19834-PA 1..169 12..197 208 36.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17946-PA 231 GE17946-PA 1..224 12..222 653 59.6 Plus

IP08144.hyp Sequence

Translation from 0 to 695

> IP08144.hyp
QRRLHIVITTAMAPRKRISRIASRSVATVEQFTKRINCRSVGTQTDILAK
GPAKRKKVENKVKLLDSQPLSSQYLAIHLMPAINPLATETINRRPDTFSY
FLPGPNEKSCQAVADRIADASDRVITASSGERQINHLKSVVSNRREEANQ
WDRNRLEILLAQINGDPPPRWNSATQLWLEVDMLEKRIEAYDQEELQNAK
NRNLDRKLDGGQDKGPSDEKDQQTLKTLKAT*

IP08144.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG17601-PA 220 CG17601-PA 1..220 12..231 1124 100 Plus