Clone IP08160 Report

Search the DGRC for IP08160

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:81
Well:60
Vector:pOT2
Associated Gene/TranscriptCG2014-RA
Protein status:IP08160.pep: gold
Preliminary Size:639
Sequenced Size:705

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2014 2005-01-01 Successful iPCR screen
CG2014 2008-04-29 Release 5.5 accounting
CG2014 2008-08-15 Release 5.9 accounting
CG2014 2008-12-18 5.12 accounting

Clone Sequence Records

IP08160.complete Sequence

705 bp (705 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022267

> IP08160.complete
CAAAGATGATAAGTTTCCTGAAATTGGCCAGGAATCCTGGCCAGCTGCTG
CTGCCTGGCAGTGGAGTGCTGCAATCCCAGTGGCTTCGTGGCCAGAAGAC
CATGCCGGTGTACGATTACCGTTGCCAAAATCCGCCAAAGTGGGGCTACT
CGGCCTTCGGACGCAACCAGAAGACCTGGGGCGAGTGGACCTGTGCCAGG
TTGGATGACCTGCTAAACTGGGGACGCAAGGGATCCCTCTGGCCGCTGAC
CTTTGGTCTCGCCTGCTGCGCCGTCGAAATGATGCACATTGCGGCTCCTC
GCTACGACATGGATCGCTACGGTGTGGTGTTCCGAGCATCTCCTCGCCAG
GCGGACGTGCTCATCGTGGCCGGAACCCTGACCAACAAGATGGCACCGGC
CTTTCGGAAGATCTACGACCAGATGCCCGAGCCGAGATGGGTCATTTCCA
TGGGCAGTTGCGCCAATGGTGGCGGCTACTACCACTACTCCTACTCGGTG
GTTCGCGGCTGCGATCGCATTGTTCCGGTGGACATCTACGTGCCCGGATG
TCCGCCCACCGCCGAGGCCTTAATGTACGGAATCCTGCAGCTGCAGAAGA
AGGTAAAGCGCATGAGGACCCTGCAGATGTGGTACAGGAAGTAGAGAATA
TTCTTGTAAGGAGTTCAGTAAATAAATGATACCTTGTTAAAAAAAAAAAA
AAAAA

IP08160.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG2014.b 769 CG2014.b 66..755 1..690 3450 100 Plus
CG2014-RA 715 CG2014-RA 32..715 5..688 3420 100 Plus
CG2014.a 762 CG2014.a 79..762 5..688 3420 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25338504..25339187 5..688 3405 99.9 Plus
chrX 22417052 chrX 15875849..15876297 643..195 1090 82.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29515844..29516529 5..690 3430 100 Plus
X 23542271 X 15986012..15986460 643..195 1090 82.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29256675..29257360 5..690 3430 100 Plus
X 23527363 X 15994110..15994558 643..195 1090 82.8 Minus
Blast to na_te.dros performed on 2019-03-16 11:18:52 has no hits.

IP08160.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:19:31 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25338501..25339187 1..688 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:41 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
CG2014-RA 1..639 6..644 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:16 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
CG2014-RA 1..639 6..644 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:20:19 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
CG2014-RA 1..639 6..644 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:15 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
CG2014-RA 1..639 6..644 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:12:01 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
CG2014-RA 1..639 6..644 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:19 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
CG2014-RA 1..639 6..644 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:16 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
CG2014-RA 29..715 1..688 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:20:19 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
CG2014-RB 66..753 1..688 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:16 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
CG2014-RA 1..639 6..644 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:12:01 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
CG2014-RB 66..753 1..688 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:19:31 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29515841..29516527 1..688 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:19:31 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29515841..29516527 1..688 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:19:31 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29515841..29516527 1..688 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:20:19 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25341563..25342249 1..688 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:14 Download gff for IP08160.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29256672..29257358 1..688 99   Plus

IP08160.hyp Sequence

Translation from 0 to 643

> IP08160.hyp
RMISFLKLARNPGQLLLPGSGVLQSQWLRGQKTMPVYDYRCQNPPKWGYS
AFGRNQKTWGEWTCARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPR
YDMDRYGVVFRASPRQADVLIVAGTLTNKMAPAFRKIYDQMPEPRWVISM
GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALMYGILQLQKK
VKRMRTLQMWYRK*

IP08160.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG2014-PB 212 CG2014-PB 1..212 2..213 1171 100 Plus
CG2014-PA 212 CG2014-PA 1..212 2..213 1171 100 Plus
CG9172-PC 221 CG9172-PC 37..221 28..213 873 85.5 Plus
CG9172-PA 221 CG9172-PA 37..221 28..213 873 85.5 Plus
CG9172-PB 221 CG9172-PB 37..221 28..213 873 85.5 Plus

IP08160.pep Sequence

Translation from 2 to 643

> IP08160.pep
KMISFLKLARNPGQLLLPGSGVLQSQWLRGQKTMPVYDYRCQNPPKWGYS
AFGRNQKTWGEWTCARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPR
YDMDRYGVVFRASPRQADVLIVAGTLTNKMAPAFRKIYDQMPEPRWVISM
GSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALMYGILQLQKK
VKRMRTLQMWYRK*

IP08160.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23350-PA 211 GF23350-PA 1..211 3..213 970 82.9 Plus
Dana\GF19983-PA 217 GF19983-PA 22..217 17..213 873 81.2 Plus
Dana\GF23344-PA 212 GF23344-PA 8..212 6..213 821 74.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11669-PA 212 GG11669-PA 1..212 2..213 1065 93.4 Plus
Dere\GG19352-PA 221 GG19352-PA 37..221 28..213 875 85.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21035-PA 226 GH21035-PA 12..226 1..213 879 75.8 Plus
Dgri\GH11286-PA 209 GH11286-PA 20..209 23..213 862 83.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
ND-20L-PB 212 CG2014-PB 1..212 2..213 1171 100 Plus
ND-20L-PA 212 CG2014-PA 1..212 2..213 1171 100 Plus
ND-20-PC 221 CG9172-PC 37..221 28..213 873 85.5 Plus
ND-20-PA 221 CG9172-PA 37..221 28..213 873 85.5 Plus
ND-20-PB 221 CG9172-PB 37..221 28..213 873 85.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18637-PA 223 GI18637-PA 32..223 21..213 860 82.4 Plus
Dmoj\GI24498-PA 205 GI24498-PA 15..205 22..213 855 81.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13892-PA 205 GL13892-PA 7..205 15..213 909 84.4 Plus
Dper\GL16625-PA 220 GL16625-PA 31..220 23..213 858 83.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15185-PA 211 GA15185-PA 1..211 2..213 917 81.1 Plus
Dpse\GA21592-PA 220 GA21592-PA 31..220 23..213 858 83.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12792-PA 204 GM12792-PA 1..204 2..213 1063 94.8 Plus
Dsec\GM11675-PA 221 GM11675-PA 37..221 28..213 874 85.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21440-PA 212 GD21440-PA 1..212 2..213 1115 98.6 Plus
Dsim\GD15767-PA 221 GD15767-PA 37..221 28..213 874 85.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21650-PA 223 GJ21650-PA 32..223 21..213 863 82.9 Plus
Dvir\GJ16291-PA 209 GJ16291-PA 20..209 23..213 859 83.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19502-PA 213 GK19502-PA 11..213 14..213 926 85.7 Plus
Dwil\GK17823-PA 229 GK17823-PA 44..229 27..213 865 84.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23857-PA 212 GE23857-PA 1..212 2..213 1082 95.3 Plus
Dyak\GE15999-PA 221 GE15999-PA 37..221 28..213 876 85.5 Plus