Clone IP08164 Report

Search the DGRC for IP08164

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:81
Well:64
Vector:pOT2
Associated Gene/TranscriptCG30038-RA
Protein status:IP08164.pep: validated full length
Preliminary Size:635
Sequenced Size:899

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30038 2005-01-01 Successful iPCR screen
CG30038 2008-04-29 Release 5.5 accounting
CG30038 2008-08-15 Release 5.9 accounting
CG30038 2008-12-18 5.12 accounting

Clone Sequence Records

IP08164.complete Sequence

899 bp (899 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022275

> IP08164.complete
CGGAAGTGAAGAAATCTACATCAAACGCCGGGGAAGAGAATGAGAAACCA
AAGGGCAAATCACGTACACGGATTCGCACGCTAGTCCACACCAACATGCA
CCAGGAGCAGATCAACGTCATCCGCAAGGCCCTGCGCAAGTTACGCGGCA
TGCGGCTGGATCCAACCGTGACCCAGCACACCACCCACCTGGTTAGCCTG
GAGCCGCGACGTACCCTGAATCTCCTGCGCGGATTGATGCGCGGAGTCTG
GATAGTTAGCTACCAGTGGGTGTTGGCCTCCATTCGGGCTGGCAAGTGGA
TCAATGAAGAGCCCTATGAGCTGACCAGGTTTTCGCGTGCAATCGAGATT
TGTCGTACAGAAAGGCAGGCCTTTGGCGTCCACTACCAGTGTGAGTTGTT
TCGCTTTATGGAGCCCTTCTATGTGTCCTCCCTCTGCCGACCGGTGCAGT
TCAACAATATGAAGGAGCTGCTCCTGCTGGGCGGTGCCACCCTGACCGAG
AACCGCTTCAAGGCCAAGTACATCATCGGGGACAAGCGGCGCGCCGAGGA
CGATCGCGTCTATCTCGATCCTTACTGGGTGCTGGACAGCATCACGAATA
TGCAAATTCAGCGCTTTGGCAAATATCTTATGAAGAGCGCCATTATCTCG
GCCGATGGGATCCGGTACGAGGATCCTAGGGATCGCGATGAGGACAAAAC
ACAAAGAAGGCACCTTCACGACTTCGTCGATCCACCGTTTGTGCTGGACA
AATAGAGATCAGTGGGTGCATCCACTTCACTTTACTAAATATTTAAGCTA
GGACACACAGAGTACCATTTTCCCACACTGTTTCACCTTTTTGTGCAAAT
TACTCCAATGTAAATATAGTTATATTTAAATAAAAAAAAAAAAAAAAAA

IP08164.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
MCPH1-RC 3322 MCPH1-RC 2313..3193 1..881 4405 100 Plus
MCPH1-RD 3503 MCPH1-RD 2494..3374 1..881 4405 100 Plus
MCPH1.b 3626 MCPH1.b 2617..3497 1..881 4405 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7783270..7783805 881..346 2680 100 Minus
chr2R 21145070 chr2R 7783867..7784087 347..127 1105 100 Minus
chr2R 21145070 chr2R 7784379..7784507 129..1 645 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11895999..11896534 881..346 2680 100 Minus
2R 25286936 2R 11896596..11896816 347..127 1105 100 Minus
2R 25286936 2R 11897108..11897236 129..1 645 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11897198..11897733 881..346 2680 100 Minus
2R 25260384 2R 11897795..11898015 347..127 1105 100 Minus
2R 25260384 2R 11898307..11898435 129..1 645 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:37:06 has no hits.

IP08164.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:37:52 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7783270..7783803 348..881 100 <- Minus
chr2R 7783867..7784085 129..347 100 <- Minus
chr2R 7784380..7784507 1..128 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:43 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
CG30038-RA 1..660 96..755 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:19:22 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
MCPH1-RD 2333..3087 1..755 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:54:35 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
MCPH1-RC 2192..2946 1..755 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:03:32 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
CG30038-RA 1..660 96..755 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:59:25 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
MCPH1-RC 2192..2946 1..755 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:19:35 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
CG30038-RA 1..881 1..881 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:19:22 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
MCPH1-RD 2484..3364 1..881 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:54:35 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
MCPH1-RC 2267..3147 1..881 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:03:32 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
CG30038-RA 1..881 1..881 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:59:25 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
MCPH1-RC 2267..3147 1..881 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:52 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11895999..11896532 348..881 100 <- Minus
2R 11896596..11896814 129..347 100 <- Minus
2R 11897109..11897236 1..128 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:52 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11895999..11896532 348..881 100 <- Minus
2R 11896596..11896814 129..347 100 <- Minus
2R 11897109..11897236 1..128 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:52 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11895999..11896532 348..881 100 <- Minus
2R 11896596..11896814 129..347 100 <- Minus
2R 11897109..11897236 1..128 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:54:35 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7784614..7784741 1..128 100   Minus
arm_2R 7784101..7784319 129..347 100 <- Minus
arm_2R 7783504..7784037 348..881 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:35 Download gff for IP08164.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11897198..11897731 348..881 100 <- Minus
2R 11897795..11898013 129..347 100 <- Minus
2R 11898308..11898435 1..128 100   Minus

IP08164.hyp Sequence

Translation from 2 to 754

> IP08164.hyp
EVKKSTSNAGEENEKPKGKSRTRIRTLVHTNMHQEQINVIRKALRKLRGM
RLDPTVTQHTTHLVSLEPRRTLNLLRGLMRGVWIVSYQWVLASIRAGKWI
NEEPYELTRFSRAIEICRTERQAFGVHYQCELFRFMEPFYVSSLCRPVQF
NNMKELLLLGGATLTENRFKAKYIIGDKRRAEDDRVYLDPYWVLDSITNM
QIQRFGKYLMKSAIISADGIRYEDPRDRDEDKTQRRHLHDFVDPPFVLDK
*

IP08164.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
MCPH1-PC 981 CG42572-PC 732..981 1..250 1314 100 Plus
MCPH1-PD 1028 CG42572-PD 779..1028 1..250 1314 100 Plus
MCPH1-PA 779 CG8981-PA 732..773 1..42 213 100 Plus
MCPH1-PB 826 CG8981-PB 779..820 1..42 213 100 Plus

IP08164.pep Sequence

Translation from 95 to 754

> IP08164.pep
MHQEQINVIRKALRKLRGMRLDPTVTQHTTHLVSLEPRRTLNLLRGLMRG
VWIVSYQWVLASIRAGKWINEEPYELTRFSRAIEICRTERQAFGVHYQCE
LFRFMEPFYVSSLCRPVQFNNMKELLLLGGATLTENRFKAKYIIGDKRRA
EDDRVYLDPYWVLDSITNMQIQRFGKYLMKSAIISADGIRYEDPRDRDED
KTQRRHLHDFVDPPFVLDK*

IP08164.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11800-PA 200 GF11800-PA 1..200 19..219 946 87.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22622-PA 203 GG22622-PA 1..203 19..219 971 94.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20404-PA 965 GH20404-PA 747..965 1..219 867 70.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
MCPH1-PC 981 CG42572-PC 763..981 1..219 1157 100 Plus
MCPH1-PD 1028 CG42572-PD 810..1028 1..219 1157 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19592-PA 221 GI19592-PA 4..221 11..219 827 70.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10244-PA 378 GL10244-PA 164..378 1..219 941 76.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24136-PA 197 GA24136-PA 1..197 19..219 859 77.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20402-PA 202 GM20402-PA 1..202 19..219 1034 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25876-PA 202 GD25876-PA 1..202 19..219 1034 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18388-PA 201 GJ18388-PA 1..201 19..219 832 76.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22251-PA 1150 GK22251-PA 930..1150 1..219 877 72.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13491-PA 203 GE13491-PA 1..203 19..219 957 93.1 Plus