Clone IP08168 Report

Search the DGRC for IP08168

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:81
Well:68
Vector:pOT2
Associated Gene/TranscriptCG30157-RA
Protein status:IP08168.pep: gold
Preliminary Size:705
Sequenced Size:1051

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30157 2005-01-01 Successful iPCR screen
CG30157 2008-04-29 Release 5.5 accounting
CG30157 2008-08-15 Release 5.9 accounting
CG30157 2008-12-18 5.12 accounting

Clone Sequence Records

IP08168.complete Sequence

1051 bp (1051 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022279

> IP08168.complete
TTTCATCATGACTCATTCTTATATTCGTTAATTTTATTTTCCGCATTATT
GTTATTTTATTTTGGCTGACTTTGTCATTGGTGCATGACGATTCAGCTTG
TACCATCTCTAGCCAGAGCAAAAAAAAAAACATTCCAATTTCTTTGCTGC
GATTTCACTTTCACAAAACAAATTACGGCTGCCCAAGGTAAATAAACAAA
AAAGAAAAGGAGCAGGTGAATCAGGCCTAGGCTATCAAATTACTCAGTTT
CGAAAACAATTCCTATGGCGGCGGAAAAGTGTGCAGAAGAGTTTGGGGAC
TCCTCCGCGGCGTCCTTGAAAATTGTACCAAAGGACTATGCATATCCACT
TCTAGAGGATCCGCAAGGCGCGCTGACCACGCCCACTGAAGGCGGGCGGA
CGCTAGTTACCCGCGGTGGCTTTAACTACTTCCACTACGGATGCGATGGC
CACCAGGATGCTGGCTGGGGTTGTGGCTACCGCACCCTGCAATCGGCCAT
TTCCTGGATCCAACGTCGACAGGGGTCGAGCGGTCATGTTCCTTCCATCC
GGGAGATTCAGCAGATCCTGGTGGCCATCGGCGACAAGGGTCCAGAGTTC
GTGGGCTCGCGCGACTGGATCGGAACGCTCGAGGAGTTCTACGTGATCGA
TGTGCTGCACCAGGTGCCGTGCAAGATTCTTCACGCCAAGGAGCTTAGCT
CGGACGAGATCCTCGGCGAGCTTCGGAGCTATTTTGAGAAGTACCAAGGC
TTCGTCGCCATGGGCGGTCTGAGTGACACCGCCTCCAAGGCTATTACCGG
CTACCATTGCAGTGCACGCGGTCGCATCTTCCTGCAGGTGGTGGATCCGC
ATTTCGTAGGCGTGCCCAGCTCCCGGCAGCACTTAATCGATCTGGGCTAC
GTTCGTTGGGTGCCCGTTGACGAGTTCGCCGGCAGCACGTACAACCTCTG
CCTCATCTTGCAGCCGTAGTCGCAACTCTCCGTACCTATTTTAGCAATAA
ATCCCGCTCAGCTCTTGATTACTATTACTTACTGAAAAAAAAAAAAAAAA
A

IP08168.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG30157-RA 1126 CG30157-RA 1..1037 1..1037 5185 100 Plus
Cyp6u1-RA 1894 Cyp6u1-RA 1..63 125..187 315 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2861699..2862542 844..1 4205 99.9 Minus
chr2R 21145070 chr2R 2861447..2861638 1034..843 960 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6974290..6975133 844..1 4220 100 Minus
2R 25286936 2R 6974035..6974229 1037..843 975 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6975489..6976332 844..1 4220 100 Minus
2R 25260384 2R 6975234..6975428 1037..843 975 100 Minus
Blast to na_te.dros performed 2019-03-15 15:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 23..85 63..1 125 70.3 Minus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 7061..7123 63..1 125 70.3 Minus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 14..74 61..2 113 67.2 Minus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 7052..7112 61..2 113 67.2 Minus

IP08168.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:26:32 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2861447..2861637 844..1034 100 <- Minus
chr2R 2861700..2862542 1..843 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:46 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
CG30157-RA 1..705 265..969 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:46 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
CG30157-RA 1..705 265..969 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:28:32 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
CG30157-RA 1..705 265..969 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:16 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
CG30157-RA 1..705 265..969 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:06:22 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
CG30157-RA 1..705 265..969 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:21 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
CG30157-RA 1..705 265..969 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:46 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
CG30157-RA 1..1034 1..1034 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:28:32 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
CG30157-RA 1..1034 1..1034 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:17 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
CG30157-RA 1..705 265..969 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:06:22 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
CG30157-RA 1..1034 1..1034 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:32 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6974291..6975133 1..843 100   Minus
2R 6974038..6974228 844..1034 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:32 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6974291..6975133 1..843 100   Minus
2R 6974038..6974228 844..1034 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:32 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6974291..6975133 1..843 100   Minus
2R 6974038..6974228 844..1034 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:28:32 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2861543..2861733 844..1034 100 <- Minus
arm_2R 2861796..2862638 1..843 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:45 Download gff for IP08168.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6975490..6976332 1..843 100   Minus
2R 6975237..6975427 844..1034 100 <- Minus

IP08168.pep Sequence

Translation from 264 to 968

> IP08168.pep
MAAEKCAEEFGDSSAASLKIVPKDYAYPLLEDPQGALTTPTEGGRTLVTR
GGFNYFHYGCDGHQDAGWGCGYRTLQSAISWIQRRQGSSGHVPSIREIQQ
ILVAIGDKGPEFVGSRDWIGTLEEFYVIDVLHQVPCKILHAKELSSDEIL
GELRSYFEKYQGFVAMGGLSDTASKAITGYHCSARGRIFLQVVDPHFVGV
PSSRQHLIDLGYVRWVPVDEFAGSTYNLCLILQP*

IP08168.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11754-PA 242 GF11754-PA 7..242 12..234 768 62.3 Plus
Dana\GF24081-PA 608 GF24081-PA 399..605 28..234 267 34.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10782-PA 233 GG10782-PA 1..233 1..234 1117 90.2 Plus
Dere\GG15911-PA 608 GG15911-PA 399..605 28..234 255 33.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19856-PA 238 GH19856-PA 19..237 19..233 677 58 Plus
Dgri\GH14744-PA 614 GH14744-PA 405..611 28..234 242 33.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG30157-PB 234 CG30157-PB 1..234 1..234 1252 100 Plus
CG30157-PA 234 CG30157-PA 1..234 1..234 1252 100 Plus
CG16979-PA 607 CG16979-PA 398..604 28..234 264 33.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19805-PA 234 GI19805-PA 10..233 14..233 695 59.4 Plus
Dmoj\GI13122-PA 612 GI13122-PA 403..609 28..234 252 33.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10959-PA 229 GL10959-PA 5..228 11..233 764 62.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15684-PA 229 GA15684-PA 5..228 11..233 764 62.1 Plus
Dpse\GA14252-PA 608 GA14252-PA 399..605 28..234 260 33.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20832-PA 234 GM20832-PA 1..234 1..234 1184 94.4 Plus
Dsec\GM25541-PA 607 GM25541-PA 398..604 28..234 253 33.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10285-PA 234 GD10285-PA 1..234 1..234 1189 94.9 Plus
Dsim\GD14556-PA 607 GD14556-PA 398..604 28..234 257 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18466-PA 237 GJ18466-PA 6..236 5..233 727 58.4 Plus
Dvir\GJ13869-PA 612 GJ13869-PA 403..609 28..234 253 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17420-PA 609 GK17420-PA 400..606 28..234 247 32.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24313-PA 233 GE24313-PA 1..233 1..234 1118 89.3 Plus
Dyak\GE23132-PA 608 GE23132-PA 399..605 28..234 256 33.2 Plus

IP08168.hyp Sequence

Translation from 264 to 968

> IP08168.hyp
MAAEKCAEEFGDSSAASLKIVPKDYAYPLLEDPQGALTTPTEGGRTLVTR
GGFNYFHYGCDGHQDAGWGCGYRTLQSAISWIQRRQGSSGHVPSIREIQQ
ILVAIGDKGPEFVGSRDWIGTLEEFYVIDVLHQVPCKILHAKELSSDEIL
GELRSYFEKYQGFVAMGGLSDTASKAITGYHCSARGRIFLQVVDPHFVGV
PSSRQHLIDLGYVRWVPVDEFAGSTYNLCLILQP*

IP08168.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG30157-PB 234 CG30157-PB 1..234 1..234 1252 100 Plus
CG30157-PA 234 CG30157-PA 1..234 1..234 1252 100 Plus
CG16979-PA 607 CG16979-PA 398..604 28..234 264 33.5 Plus