Clone IP08207 Report

Search the DGRC for IP08207

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:82
Well:7
Vector:pOT2
Associated Gene/Transcriptglob2-RB
Protein status:IP08207.pep: gold
Preliminary Size:693
Sequenced Size:784

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15180 2005-01-01 Successful iPCR screen
CG15180 2008-04-29 Release 5.5 accounting
CG15180 2008-08-15 Release 5.9 accounting
glob2 2008-12-18 5.12 accounting

Clone Sequence Records

IP08207.complete Sequence

784 bp (784 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022295

> IP08207.complete
CCCGTTGAAAAGTCCAAGGAAATGAGCCAAATCAGCAAACTAACCCACAT
AAGCCGCATAAGCCAAAACAATCAGTCGGACGGGAGTGATGAGGATAAGT
TTCGCCGTGCGAATTTTCCGGTTTACCCAAAACCGCTACCTGATCGAGAT
TTGAGCTACAAAGCTGACGAAAATGAGTTCACAATGGTGGAGAAGGCGTC
CTTGCGGAATGCCTGGCGTTTAATTGAGCCATTTCAGCGCCGATTTGGCA
AGGAAAATTTTTACAGTTTCCTTACGAGGAACGAGGATCTCATAAACTTT
TTCAGGAAAGATGGAAAGATTAACCTGAGTAAGCTGCACGGGCATGCCAT
GGCAATGATGAAGCTGATGTCAAAGCTGGTCCAAACACTGGATTGCAATC
TAGCTTTCCGCTTGGCCTTGGATGAGAATCTTCCCACACATCTGAAGAAT
GGCATCGATCCGGATTATATGAGGATGCTGGCCACCGCACTGAAGAGTTA
TATCCTTGCGTCTTCCGTTATCGAAAATCACAACTCATGTTCACTAAGCA
ATGGTCTGGCCCGTCTGGTGGAGATCGTCGGTGAGTACGCCGTTGTGGAT
GAGGCTAGAAAAAGAGCCATGTCCACTGCCCTTAGGACGACTGTTGACGA
TGCTGGCAATCGCATTGTCAAGGTTGCTTTAGGCACTTAAACGGGAACAA
AAATAATGTAAATACCTATATTGTACAGACATTGCTTGCAGTAAAAAGAA
AATTAAAATGTGAATTCGAAAAAAAAAAAAAAAA

IP08207.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
glob2-RB 907 glob2-RB 136..905 1..770 3850 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2433703..2433997 768..474 1460 99.7 Minus
chr3R 27901430 chr3R 2434384..2434649 266..1 1330 100 Minus
chr3R 27901430 chr3R 2434124..2434333 474..265 1050 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6607911..6608207 770..474 1485 100 Minus
3R 32079331 3R 6608594..6608859 266..1 1330 100 Minus
3R 32079331 3R 6608334..6608543 474..265 1050 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6348742..6349038 770..474 1485 100 Minus
3R 31820162 3R 6349425..6349690 266..1 1330 100 Minus
3R 31820162 3R 6349165..6349374 474..265 1050 100 Minus
Blast to na_te.dros performed 2019-03-16 03:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Juan 4236 Juan JUAN 4236bp 3413..3526 651..759 107 58.8 Plus

IP08207.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:26:55 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2433703..2433996 475..768 99 <- Minus
chr3R 2434124..2434331 267..474 100 <- Minus
chr3R 2434384..2434649 1..266 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:35:56 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
glob2-RA 1..232 22..253 100 == Plus
glob2-RA 233..630 294..690 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:40 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
glob2-RB 1..669 22..690 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:57:55 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
glob2-RB 1..669 22..690 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:42 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
CG15180-RA 1..232 22..253 100 == Plus
CG15180-RA 233..630 294..690 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:37:15 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
glob2-RB 1..669 22..690 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:49 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
glob2-RA 1..253 1..253 100 == Plus
glob2-RA 254..729 294..768 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:40 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
glob2-RB 56..823 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:57:55 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
glob2-RB 56..823 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:42 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
CG15180-RA 1..253 1..253 100 == Plus
CG15180-RA 254..729 294..768 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:37:15 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
glob2-RB 56..823 1..768 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:26:55 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6607913..6608206 475..768 100 <- Minus
3R 6608334..6608541 267..474 100 <- Minus
3R 6608594..6608859 1..266 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:26:55 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6607913..6608206 475..768 100 <- Minus
3R 6608334..6608541 267..474 100 <- Minus
3R 6608594..6608859 1..266 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:26:55 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6607913..6608206 475..768 100 <- Minus
3R 6608334..6608541 267..474 100 <- Minus
3R 6608594..6608859 1..266 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:57:55 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2433635..2433928 475..768 100 <- Minus
arm_3R 2434056..2434263 267..474 100 <- Minus
arm_3R 2434316..2434581 1..266 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:01:09 Download gff for IP08207.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6348744..6349037 475..768 100 <- Minus
3R 6349165..6349372 267..474 100 <- Minus
3R 6349425..6349690 1..266 100   Minus

IP08207.hyp Sequence

Translation from 0 to 689

> IP08207.hyp
PVEKSKEMSQISKLTHISRISQNNQSDGSDEDKFRRANFPVYPKPLPDRD
LSYKADENEFTMVEKASLRNAWRLIEPFQRRFGKENFYSFLTRNEDLINF
FRKDGKINLSKLHGHAMAMMKLMSKLVQTLDCNLAFRLALDENLPTHLKN
GIDPDYMRMLATALKSYILASSVIENHNSCSLSNGLARLVEIVGEYAVVD
EARKRAMSTALRTTVDDAGNRIVKVALGT*

IP08207.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
glob2-PB 222 CG15180-PB 1..222 8..229 1132 100 Plus
glob2-PD 209 CG15180-PD 1..209 8..229 1041 94.1 Plus
glob2-PC 219 CG15180-PC 1..186 8..193 958 100 Plus
glob3-PA 196 CG14675-PA 18..169 42..196 228 35.5 Plus

IP08207.pep Sequence

Translation from 21 to 689

> IP08207.pep
MSQISKLTHISRISQNNQSDGSDEDKFRRANFPVYPKPLPDRDLSYKADE
NEFTMVEKASLRNAWRLIEPFQRRFGKENFYSFLTRNEDLINFFRKDGKI
NLSKLHGHAMAMMKLMSKLVQTLDCNLAFRLALDENLPTHLKNGIDPDYM
RMLATALKSYILASSVIENHNSCSLSNGLARLVEIVGEYAVVDEARKRAM
STALRTTVDDAGNRIVKVALGT*

IP08207.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16358-PA 206 GF16358-PA 23..190 28..207 664 67.8 Plus
Dana\GF16359-PA 206 GF16359-PA 14..172 25..184 198 30.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10391-PA 222 GG10391-PA 1..222 1..222 1084 89.2 Plus
Dere\GG13071-PA 225 GG13071-PA 17..169 34..189 237 36.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18925-PA 208 GH18925-PA 6..174 11..184 276 35.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
glob2-PB 222 CG15180-PB 1..222 1..222 1132 100 Plus
glob2-PD 209 CG15180-PD 1..209 1..222 1041 94.1 Plus
glob2-PC 219 CG15180-PC 1..186 1..186 958 100 Plus
glob3-PA 196 CG14675-PA 18..169 35..189 228 35.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23233-PA 192 GI23233-PA 23..170 34..184 246 33.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24032-PA 209 GL24032-PA 27..189 34..199 270 37.3 Plus
Dper\GL24031-PA 107 GL24031-PA 2..83 126..207 253 62.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26482-PB 218 GA26482-PB 19..194 32..207 643 66.5 Plus
Dpse\GA26483-PA 209 GA26483-PA 27..189 34..199 263 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10544-PA 209 GM10544-PA 1..209 1..222 1021 86.9 Plus
Dsec\GM10846-PA 196 GM10846-PA 18..169 35..189 243 36.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19540-PA 209 GD19540-PA 1..209 1..222 1036 88.3 Plus
Dsim\GD19828-PA 196 GD19828-PA 18..169 35..189 245 36.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22893-PA 208 GJ22893-PA 29..176 34..184 279 35.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24567-PA 218 GK24567-PA 19..191 31..203 567 58.4 Plus
Dwil\GK17234-PA 215 GK17234-PA 23..176 33..183 251 35.3 Plus
Dwil\GK14442-PA 206 GK14442-PA 21..186 33..203 186 30.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24095-PA 209 GE24095-PA 1..209 1..222 966 81.5 Plus
Dyak\GE10172-PA 225 GE10172-PA 17..169 34..189 235 35.3 Plus