Clone IP08242 Report

Search the DGRC for IP08242

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:82
Well:42
Vector:pOT2
Associated Gene/TranscriptGstE10-RA
Protein status:IP08242.pep: gold
Preliminary Size:723
Sequenced Size:907

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17522 2005-01-01 Successful iPCR screen
GstE10 2008-04-29 Release 5.5 accounting
GstE10 2008-08-15 Release 5.9 accounting
GstE10 2008-12-18 5.12 accounting

Clone Sequence Records

IP08242.complete Sequence

907 bp (907 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022315

> IP08242.complete
CACACTGTCTGCTACGAATCTCAATTCAACCAGCTAGAAGGCAATTAGTT
AAGCAACCACAATGGCTAACCTGATTCTATATGGCACTGAGTCCAGTCCG
CCGGTCCGTGCCGTTTTGTTGACCCTTCGTGCCCTCCAGCTGGACCATGA
ATTCCATACGCTGGACATGCAGGCCGGCGATCATCTGAAGCCGGATATGT
TACGCAAGAATCCCCAGCACACGGTACCCATGCTGGAGGATGGTGAGTCA
TGCATTTGGGACTCACACGCCATCATCGGCTATCTGGTGAACAAGTACGC
CCAGTCGGATGAGCTCTATCCAAAGGATCCGCTGAAGCGAGCTGTGGTGG
ATCAGCGGCTGCATTTCGAGACCGGTGTCCTTTTTCACGGCATCTTCAAG
CAATTGCAGAGAGCTCTGTTCAAAGAGAATGCCACTGAGGTGCCCAAGGA
TCGTTTGGCTGAGTTGAAGGATGCCTACGCCTTGCTGGAGCAATTTCTGG
CGGAGAATCCCTATGTGGCCGGTCCTCAGCTGACCATCGCCGATTTTAGC
ATTGTGGCCACCGTGAGCACTCTGCACCTGAGCTACTGTCCCGTGGATGC
GACCAAATACCCCAAATTATCCGCCTGGTTGGCACGTATCTCCGCATTGC
CCTTCTATGAGGAGGACAACTTGAGAGGAGCCCGCTTGTTGGCCGATAAG
ATTCGCTCCAAGCTGCCCAAGCAGTTTGACAAGCTGTGGCAAAAGGCCTT
TGAGGACATCAAGAGCGGAGCTGGAAAACAGTGATGCGGAAGCCATTGTC
GCATCGAAAAGAGAGCATTGCCCAAAGTAAAATTGTATGTTAAATGGTAT
TTAATATGATGTATTAAAACTTACGCTGCTGGCAAAATGAAAAAAAAAAA
AAAAAAA

IP08242.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
GstE10-RA 723 GstE10-RA 1..723 62..784 3615 100 Plus
GstE5-RA 719 GstE5-RA 159..325 206..372 280 77.8 Plus
GstE4-RA 812 GstE4-RA 145..318 206..379 270 77 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14283677..14284563 889..3 4390 99.7 Minus
chr2R 21145070 chr2R 14291821..14291987 206..372 280 77.8 Plus
chr2R 21145070 chr2R 14290465..14290638 206..379 270 77 Plus
chr2R 21145070 chr2R 14294116..14294285 206..375 250 76.5 Plus
chr2R 21145070 chr2R 14285628..14285751 206..329 245 79.8 Plus
chr2R 21145070 chr2R 14295024..14295193 206..375 205 74.7 Plus
chr2R 21145070 chr2R 14286768..14286868 257..357 190 79.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18396637..18397526 890..1 4450 100 Minus
2R 25286936 2R 18404778..18404944 206..372 280 77.8 Plus
2R 25286936 2R 18403419..18403592 206..379 270 77 Plus
2R 25286936 2R 18407099..18407268 206..375 250 76.5 Plus
2R 25286936 2R 18398582..18398705 206..329 245 79.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18397836..18398725 890..1 4450 100 Minus
2R 25260384 2R 18404618..18404791 206..379 270 77 Plus
2R 25260384 2R 18399781..18399904 206..329 245 79.8 Plus
2R 25260384 2R 18406024..18406143 253..372 240 80 Plus
2R 25260384 2R 18408349..18408467 257..375 205 78.1 Plus
Blast to na_te.dros performed on 2019-03-16 03:29:21 has no hits.

IP08242.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:30:30 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14283677..14284564 1..889 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:10 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
GstE10-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:49 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
GstE10-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:46 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
GstE10-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:19 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
GstE10-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:38:38 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
GstE10-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:26 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
GstE10-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:49 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
GstE10-RA 1..889 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:46 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
GstE10-RA 1..889 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:19 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
GstE10-RA 1..723 62..784 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:38:38 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
GstE10-RA 1..889 1..889 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:30 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18396638..18397526 1..889 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:30 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18396638..18397526 1..889 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:30 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18396638..18397526 1..889 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:46 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14284143..14285031 1..889 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:48 Download gff for IP08242.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18397837..18398725 1..889 100   Minus

IP08242.hyp Sequence

Translation from 61 to 783

> IP08242.hyp
MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKN
PQHTVPMLEDGESCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRL
HFETGVLFHGIFKQLQRALFKENATEVPKDRLAELKDAYALLEQFLAENP
YVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFYE
EDNLRGARLLADKIRSKLPKQFDKLWQKAFEDIKSGAGKQ*

IP08242.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
GstE10-PB 240 CG17522-PB 1..240 1..240 1247 100 Plus
GstE10-PA 240 CG17522-PA 1..240 1..240 1247 100 Plus
GstE7-PA 223 CG17531-PA 1..214 1..215 597 54.9 Plus
GstE9-PA 221 CG17534-PA 1..219 1..220 578 50.5 Plus
GstE6-PA 222 CG17530-PA 1..209 1..210 575 53.3 Plus

IP08242.pep Sequence

Translation from 61 to 783

> IP08242.pep
MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKN
PQHTVPMLEDGESCIWDSHAIIGYLVNKYAQSDELYPKDPLKRAVVDQRL
HFETGVLFHGIFKQLQRALFKENATEVPKDRLAELKDAYALLEQFLAENP
YVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFYE
EDNLRGARLLADKIRSKLPKQFDKLWQKAFEDIKSGAGKQ*

IP08242.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12766-PA 241 GF12766-PA 1..238 1..237 1102 85.7 Plus
Dana\GF12168-PA 219 GF12168-PA 1..216 1..218 594 51.4 Plus
Dana\GF12173-PA 221 GF12173-PA 1..213 1..215 583 52.6 Plus
Dana\GF12171-PA 222 GF12171-PA 1..216 1..217 579 49.8 Plus
Dana\GF12174-PA 221 GF12174-PA 1..210 1..212 564 50.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20973-PA 240 GG20973-PA 1..240 1..240 1237 95.8 Plus
Dere\GG21887-PA 222 GG21887-PA 1..215 1..216 587 50.5 Plus
Dere\GG21889-PA 222 GG21889-PA 1..213 1..215 585 53 Plus
Dere\GG21885-PA 219 GG21885-PA 1..216 1..218 578 48.6 Plus
Dere\GG21886-PA 222 GG21886-PA 1..216 1..217 575 48.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20218-PA 231 GH20218-PA 3..230 4..239 781 64.3 Plus
Dgri\GH21671-PA 221 GH21671-PA 1..219 1..220 591 50.9 Plus
Dgri\GH21669-PA 221 GH21669-PA 1..213 1..215 587 50.7 Plus
Dgri\GH21668-PA 217 GH21668-PA 1..216 1..218 572 50.5 Plus
Dgri\GH15974-PA 219 GH15974-PA 1..214 1..216 535 47.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
GstE10-PB 240 CG17522-PB 1..240 1..240 1247 100 Plus
GstE10-PA 240 CG17522-PA 1..240 1..240 1247 100 Plus
GstE7-PA 223 CG17531-PA 1..214 1..215 597 54.9 Plus
GstE9-PA 221 CG17534-PA 1..219 1..220 578 50.5 Plus
GstE6-PA 222 CG17530-PA 1..209 1..210 575 53.3 Plus
GstE2-PA 221 CG17523-PA 5..207 4..208 569 54.6 Plus
GstE5-PA 222 CG17527-PA 1..215 1..216 564 50.5 Plus
GstE4-PA 222 CG17525-PA 1..216 1..217 549 47.9 Plus
GstE8-PB 222 CG17533-PB 1..214 1..215 543 50.2 Plus
GstE8-PA 222 CG17533-PA 1..214 1..215 543 50.2 Plus
GstE1-PA 224 CG5164-PA 4..224 2..224 525 47.5 Plus
GstE3-PA 220 CG17524-PA 1..215 1..217 513 48.4 Plus
GstE12-PC 223 CG16936-PC 1..223 1..224 458 43.6 Plus
GstE12-PB 223 CG16936-PB 1..223 1..224 458 43.6 Plus
GstE12-PD 223 CG16936-PD 1..223 1..224 458 43.6 Plus
GstE12-PA 223 CG16936-PA 1..223 1..224 458 43.6 Plus
GstE11-PB 225 CG5224-PB 3..225 2..224 440 42.2 Plus
GstE11-PA 225 CG5224-PA 3..225 2..224 440 42.2 Plus
GstE13-PB 226 CG11784-PB 1..216 1..216 371 39 Plus
GstE13-PA 226 CG11784-PA 1..216 1..216 371 39 Plus
GstD9-PB 218 CG10091-PB 10..199 12..202 362 39.6 Plus
GstD9-PA 218 CG10091-PA 10..199 12..202 362 39.6 Plus
GstD1-PB 209 CG10045-PB 5..197 7..202 347 37.1 Plus
GstD1-PA 209 CG10045-PA 5..197 7..202 347 37.1 Plus
GstD8-PA 212 CG4421-PA 9..210 12..217 345 35.4 Plus
GstD7-PA 224 CG4371-PA 1..213 1..212 344 37.8 Plus
GstD6-PA 215 CG4423-PA 3..215 6..218 343 36.4 Plus
GstD2-PA 215 CG4181-PA 13..182 16..189 331 41.4 Plus
GstD4-PA 215 CG11512-PA 4..199 7..206 330 36 Plus
GstD11-PA 222 CG17639-PA 1..217 1..218 322 35.3 Plus
GstD11-PB 243 CG17639-PB 22..238 1..218 322 35.3 Plus
GstD5-PA 216 CG12242-PA 13..200 16..207 319 37.5 Plus
GstE14-PA 232 CG4688-PA 7..220 5..222 305 33.5 Plus
GstD10-PB 210 CG18548-PB 3..202 6..208 295 33.7 Plus
GstD10-PA 210 CG18548-PA 3..202 6..208 295 33.7 Plus
GstD3-PA 199 CG4381-PA 4..194 23..217 287 32.3 Plus
gfzf-PD 234 CG33546-PD 3..184 6..189 227 31.2 Plus
gfzf-PE 1045 CG33546-PE 814..995 6..189 227 31.2 Plus
gfzf-PB 1045 CG33546-PB 814..995 6..189 227 31.2 Plus
GstT1-PA 228 CG30000-PA 13..211 12..201 177 25.6 Plus
GstT2-PA 228 CG30005-PA 13..211 12..201 162 25.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19388-PA 241 GI19388-PA 3..238 4..240 855 67.9 Plus
Dmoj\GI20124-PA 221 GI20124-PA 1..219 1..220 609 50.9 Plus
Dmoj\GI20121-PA 222 GI20121-PA 1..216 1..217 591 49.8 Plus
Dmoj\GI20123-PA 221 GI20123-PA 1..213 1..215 556 48.8 Plus
Dmoj\GI16624-PA 219 GI16624-PA 1..206 1..208 538 49 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16704-PA 241 GL16704-PA 1..241 1..240 1075 82.2 Plus
Dper\GL17771-PA 221 GL17771-PA 1..215 1..217 568 50.7 Plus
Dper\GL17769-PA 219 GL17769-PA 1..206 1..208 559 51.4 Plus
Dper\GL17773-PA 222 GL17773-PA 1..214 1..215 553 49.3 Plus
Dper\GL17774-PA 221 GL17774-PA 1..219 1..220 550 49.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:00:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14539-PA 241 GA14539-PA 1..241 1..240 1080 82.6 Plus
Dpse\GA14542-PA 221 GA14542-PA 1..215 1..217 566 50.2 Plus
Dpse\GA14545-PA 222 GA14545-PA 1..214 1..215 560 49.8 Plus
Dpse\GA14540-PA 219 GA14540-PA 1..216 1..218 559 49.5 Plus
Dpse\GA14548-PA 221 GA14548-PA 1..219 1..220 538 49.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:00:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19908-PA 240 GM19908-PA 1..240 1..240 1256 98.3 Plus
Dsec\GM21881-PA 223 GM21881-PA 1..214 1..215 606 54 Plus
Dsec\GM21875-PA 221 GM21875-PA 5..207 4..208 597 55.6 Plus
Dsec\GM21880-PA 222 GM21880-PA 1..215 1..216 590 51.9 Plus
Dsec\GM21878-PA 219 GM21878-PA 1..216 1..218 574 49.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:00:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25394-PA 240 GD25394-PA 1..240 1..240 1271 99.6 Plus
Dsim\GD11376-PA 223 GD11376-PA 1..214 1..215 615 54 Plus
Dsim\GD11375-PA 222 GD11375-PA 1..209 1..210 590 53.3 Plus
Dsim\GD11374-PA 222 GD11374-PA 1..215 1..216 576 50 Plus
Dsim\GD11372-PA 219 GD11372-PA 1..216 1..218 574 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22450-PA 238 GJ22450-PA 3..238 4..240 936 74.7 Plus
Dvir\GJ19893-PA 221 GJ19893-PA 1..215 1..217 594 53.5 Plus
Dvir\GJ19891-PA 222 GJ19891-PA 1..216 1..217 579 49.8 Plus
Dvir\GJ19894-PA 221 GJ19894-PA 1..219 1..220 575 47.3 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 1..206 1..208 574 52.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23233-PA 243 GK23233-PA 3..243 4..240 950 72.6 Plus
Dwil\GK22983-PA 222 GK22983-PA 1..216 1..217 592 49.8 Plus
Dwil\GK22991-PA 222 GK22991-PA 1..216 1..217 584 49.8 Plus
Dwil\GK22989-PA 220 GK22989-PA 1..213 1..216 560 50 Plus
Dwil\GK22990-PA 220 GK22990-PA 1..213 1..216 556 49.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13914-PA 240 GE13914-PA 1..240 1..240 1231 95.4 Plus
Dyak\GE11964-PA 222 GE11964-PA 1..215 1..217 601 53.5 Plus
Dyak\GE11963-PA 222 GE11963-PA 1..209 1..210 591 53.3 Plus
Dyak\GstE2-PA 221 GE11957-PA 5..205 4..206 581 54.7 Plus
Dyak\GE11962-PA 222 GE11962-PA 1..215 1..216 577 50.9 Plus