Clone IP08243 Report

Search the DGRC for IP08243

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:82
Well:43
Vector:pOT2
Associated Gene/TranscriptGstE4-RA
Protein status:IP08243.pep: validated not full length
Preliminary Size:669
Sequenced Size:827

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17525 2005-01-01 Successful iPCR screen
GstE4 2008-04-29 Release 5.5 accounting
GstE4 2008-08-15 Release 5.9 accounting
GstE4 2008-12-18 5.12 accounting

Clone Sequence Records

IP08243.complete Sequence

827 bp (827 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022319

> IP08243.complete
GGTAAGATATCGCTATACGGCCTGGACGCAAGTCCGCCAACACGGGCATG
TCTGCTCACCCTGAAGGCACTGGATCTGCCCTTCGAATTTGTGTTCGTCA
ATCTGTTCGAGAAGGAGAACTTTAGCGAGGACTTCTCGAAGAAGAATCCA
CAGCACACGGTGCCACTGCTGCAGGACGATGATGCCTGCATCTGGGACTC
CCATGCCATCATGGCGTATCTGGTGGAAAAGTACGCGCCAAGCGATGAGC
TCTATCCCAAGGATCTGCTGCAGCGTGCCAAAGTGGACCAATTGATGCAC
TTCGAGTCGGGTGTCATCTTCGAGTCTGCCCTAAGGAGACTCACCCGTCC
GGTGCTCTTCTTCGGCGAGCCCACCTTGCCCCGCAATCAGGTGGATCACA
TCCTTCAGGTCTATGATTTCGTAGAGACCTTTCTCGATGATCACGACTTC
GTGGCCGGCGATCAGTTGACCATAGCCGATTTCAGCATCGTATCGACCAT
CACCTCGATTGGTGTTTTCCTGGAGCTGGATCCGGCCAAGTACCCTAAGA
TTGCCGCCTGGCTGGAGAGGCTTAAGGAGCTGCCCTACTACGAGGAGGCC
AATGGCAAAGGAGCTGCCCAGTTCGTGGAGCTCTTGAGGTCCAAAAACTT
CACCATAGTTTCGTAAGCACTAGTCTTGATTTCGACAGTAAATGGCTTAA
CATTTTAATTGGAAATTATCGCTTTCACAGAATTGATATTAGCAAACAAA
AAAAAATGTTCTTTGTTTTGTGTTCAAATTATGCAATTAAATAGGCAAAG
CACCCCCCTAAAAAAAAAAAAAAAAAA

IP08243.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
GstE4-RA 812 GstE4-RA 4..812 1..809 4045 100 Plus
GstE5-RA 719 GstE5-RA 159..242 142..225 210 83.3 Plus
GstE5-RA 719 GstE5-RA 427..503 410..486 145 79.2 Plus
GstE7-RA 754 GstE7-RA 601..638 578..615 145 92.1 Plus
GstE7-RA 754 GstE7-RA 161..204 138..181 145 88.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14290324..14291133 1..809 3910 99.1 Plus
chr2R 21145070 chr2R 14284187..14284360 315..142 285 77.6 Minus
chr2R 21145070 chr2R 14294086..14294296 112..322 215 73.5 Plus
chr2R 21145070 chr2R 14291821..14291904 142..225 210 83.3 Plus
chr2R 21145070 chr2R 14294381..14294589 407..615 205 73.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18403278..18404090 1..813 4065 100 Plus
2R 25286936 2R 18397148..18397321 315..142 270 77 Minus
2R 25286936 2R 18404778..18404861 142..225 210 83.3 Plus
2R 25286936 2R 18407095..18407279 138..322 205 74.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18404477..18405289 1..813 4065 100 Plus
2R 25260384 2R 18398347..18398520 315..142 270 77 Minus
2R 25260384 2R 18405977..18406060 142..225 210 83.3 Plus
2R 25260384 2R 18407383..18407467 140..224 155 78.8 Plus
2R 25260384 2R 18408734..18408771 578..615 145 92.1 Plus
2R 25260384 2R 18406245..18406321 410..486 145 79.2 Plus
2R 25260384 2R 18408294..18408337 138..181 145 88.6 Plus
Blast to na_te.dros performed on 2019-03-15 19:24:35 has no hits.

IP08243.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:31 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14290324..14291133 1..809 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:11 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
GstE4-RA 4..669 1..666 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:19:12 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
GstE4-RA 4..669 1..666 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:28 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
GstE4-RA 4..669 1..666 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:03:23 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
GstE4-RA 4..669 1..666 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:17:20 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
GstE4-RA 4..669 1..666 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:19:22 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
GstE4-RA 4..669 1..666 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:19:12 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
GstE4-RA 4..812 1..809 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:28 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
GstE4-RA 31..839 1..809 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:03:24 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
GstE4-RA 4..669 1..666 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:17:20 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
GstE4-RA 31..839 1..809 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:31 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18403278..18404086 1..809 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:31 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18403278..18404086 1..809 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:31 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18403278..18404086 1..809 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:28 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14290783..14291591 1..809 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:25 Download gff for IP08243.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18404477..18405285 1..809 100   Plus

IP08243.pep Sequence

Translation from 0 to 665

> IP08243.pep
GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNP
QHTVPLLQDDDACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMH
FESGVIFESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHDF
VAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKELPYYEEA
NGKGAAQFVELLRSKNFTIVS*

IP08243.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12169-PA 221 GF12169-PA 2..220 1..220 1018 85 Plus
Dana\GF12171-PA 222 GF12171-PA 2..219 1..218 740 60.1 Plus
Dana\GF12173-PA 221 GF12173-PA 2..218 1..218 694 56.9 Plus
Dana\GF12174-PA 221 GF12174-PA 2..221 1..221 681 57 Plus
Dana\GF12172-PA 222 GF12172-PA 4..219 3..218 651 51.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21886-PA 222 GG21886-PA 2..222 1..221 1101 94.1 Plus
Dere\GG21887-PA 222 GG21887-PA 2..222 1..221 743 58.8 Plus
Dere\GG21889-PA 222 GG21889-PA 3..221 2..221 733 61.4 Plus
Dere\GG21890-PA 222 GG21890-PA 3..219 2..218 716 59 Plus
Dere\GG21888-PA 240 GG21888-PA 21..237 2..218 701 57.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21668-PA 217 GH21668-PA 2..215 1..215 700 59.1 Plus
Dgri\GH21669-PA 221 GH21669-PA 3..219 2..219 639 51.8 Plus
Dgri\GH21671-PA 221 GH21671-PA 2..216 1..215 618 49.8 Plus
Dgri\GH15974-PA 219 GH15974-PA 3..219 2..220 606 52.1 Plus
Dgri\GH13568-PA 220 GH13568-PA 3..214 2..215 512 47.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
GstE4-PA 222 CG17525-PA 2..222 1..221 1146 100 Plus
GstE7-PA 223 CG17531-PA 3..222 2..221 724 63.3 Plus
GstE8-PB 222 CG17533-PB 3..219 2..218 702 59 Plus
GstE8-PA 222 CG17533-PA 3..219 2..218 702 59 Plus
GstE5-PA 222 CG17527-PA 3..222 2..221 702 57.7 Plus
GstE6-PA 222 CG17530-PA 3..219 2..218 674 56.2 Plus
GstE3-PA 220 CG17524-PA 2..220 1..220 584 50.5 Plus
GstE9-PA 221 CG17534-PA 2..221 1..220 578 47.7 Plus
GstE2-PA 221 CG17523-PA 4..214 2..213 561 50 Plus
GstE10-PB 240 CG17522-PB 6..217 5..215 544 48.6 Plus
GstE10-PA 240 CG17522-PA 6..217 5..215 544 48.6 Plus
GstE1-PA 224 CG5164-PA 6..217 3..215 529 49.3 Plus
GstE12-PC 223 CG16936-PC 3..216 2..215 484 45.6 Plus
GstE12-PB 223 CG16936-PB 3..216 2..215 484 45.6 Plus
GstE12-PD 223 CG16936-PD 3..216 2..215 484 45.6 Plus
GstE12-PA 223 CG16936-PA 3..216 2..215 484 45.6 Plus
GstE11-PB 225 CG5224-PB 7..216 5..213 405 37.9 Plus
GstE11-PA 225 CG5224-PA 7..216 5..213 405 37.9 Plus
GstE13-PB 226 CG11784-PB 3..207 2..205 382 39.8 Plus
GstE13-PA 226 CG11784-PA 3..207 2..205 382 39.8 Plus
GstD11-PB 243 CG17639-PB 20..237 1..215 355 37.5 Plus
GstD11-PA 222 CG17639-PA 6..216 5..215 353 37.3 Plus
GstD8-PA 212 CG4421-PA 1..211 3..216 347 34.1 Plus
GstD6-PA 215 CG4423-PA 1..195 3..199 338 34.8 Plus
GstD5-PA 216 CG12242-PA 13..202 15..207 333 35.8 Plus
GstD1-PB 209 CG10045-PB 2..204 3..208 331 34.5 Plus
GstD1-PA 209 CG10045-PA 2..204 3..208 331 34.5 Plus
GstE14-PA 232 CG4688-PA 8..214 5..214 331 34.8 Plus
GstD3-PA 199 CG4381-PA 4..194 22..215 322 34.2 Plus
GstD10-PB 210 CG18548-PB 1..204 3..208 321 33.8 Plus
GstD10-PA 210 CG18548-PA 1..204 3..208 321 33.8 Plus
GstD2-PA 215 CG4181-PA 1..199 3..204 319 34.7 Plus
GstD4-PA 215 CG11512-PA 1..214 3..219 318 32.3 Plus
GstD7-PA 224 CG4371-PA 4..199 3..199 317 34.2 Plus
GstD9-PB 218 CG10091-PB 2..209 3..211 288 34.4 Plus
GstD9-PA 218 CG10091-PA 2..209 3..211 288 34.4 Plus
gfzf-PD 234 CG33546-PD 1..202 3..204 275 32.5 Plus
gfzf-PE 1045 CG33546-PE 812..1013 3..204 275 32.5 Plus
gfzf-PB 1045 CG33546-PB 812..1013 3..204 275 32.5 Plus
GstT1-PA 228 CG30000-PA 13..228 11..216 209 26.9 Plus
GstT3-PC 228 CG1702-PC 13..213 11..201 197 30.6 Plus
GstT3-PA 228 CG1702-PA 13..213 11..201 197 30.6 Plus
GstT3-PB 268 CG1702-PB 53..253 11..201 197 30.6 Plus
GstT2-PA 228 CG30005-PA 13..211 11..199 182 28.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20121-PA 222 GI20121-PA 3..222 2..221 736 58.6 Plus
Dmoj\GI20122-PA 221 GI20122-PA 6..221 5..221 656 58.5 Plus
Dmoj\GI20123-PA 221 GI20123-PA 4..219 3..219 643 53 Plus
Dmoj\GI16623-PA 219 GI16623-PA 2..219 1..220 633 52.3 Plus
Dmoj\GI16624-PA 219 GI16624-PA 2..219 1..220 626 53.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17771-PA 221 GL17771-PA 2..220 1..220 941 80.5 Plus
Dper\GL17773-PA 222 GL17773-PA 3..222 2..221 707 57.3 Plus
Dper\GL17772-PA 222 GL17772-PA 2..222 1..220 590 50 Plus
Dper\GL17770-PA 222 GL17770-PA 2..222 1..220 580 49.5 Plus
Dper\GL17774-PA 221 GL17774-PA 2..221 1..220 571 48.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14542-PA 221 GA14542-PA 2..220 1..220 934 79.5 Plus
Dpse\GA14545-PA 222 GA14545-PA 3..222 2..221 712 58.2 Plus
Dpse\GA14541-PA 222 GA14541-PA 2..222 1..220 587 50 Plus
Dpse\GA24907-PA 222 GA24907-PA 2..222 1..220 584 50 Plus
Dpse\GA14540-PA 219 GA14540-PA 4..219 3..220 572 50.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21879-PA 222 GM21879-PA 2..222 1..221 1132 95.9 Plus
Dsec\GM21881-PA 223 GM21881-PA 3..222 2..221 720 62 Plus
Dsec\GM21882-PA 222 GM21882-PA 3..219 2..218 712 59 Plus
Dsec\GM21880-PA 222 GM21880-PA 3..222 2..221 703 56.8 Plus
Dsec\GM21876-PA 220 GM21876-PA 2..220 1..220 588 50.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11373-PA 222 GD11373-PA 2..222 1..221 1131 95.9 Plus
Dsim\GD11376-PA 223 GD11376-PA 3..222 2..221 735 61.4 Plus
Dsim\GD11377-PA 222 GD11377-PA 3..219 2..218 724 59 Plus
Dsim\GD11374-PA 222 GD11374-PA 3..222 2..221 708 57.3 Plus
Dsim\GD11375-PA 222 GD11375-PA 3..219 2..218 698 57.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19891-PA 222 GJ19891-PA 2..222 1..221 787 65.2 Plus
Dvir\GJ19893-PA 221 GJ19893-PA 2..220 1..220 686 57.7 Plus
Dvir\GJ19892-PA 219 GJ19892-PA 2..218 1..220 672 56.4 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 2..219 1..220 614 53.2 Plus
Dvir\GJ19894-PA 221 GJ19894-PA 2..221 1..220 608 45.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22983-PA 222 GK22983-PA 2..222 1..221 934 76.5 Plus
Dwil\GK22991-PA 222 GK22991-PA 3..220 2..219 716 58.3 Plus
Dwil\GK22989-PA 220 GK22989-PA 3..220 2..221 638 55 Plus
Dwil\GK22990-PA 220 GK22990-PA 3..220 2..221 625 53.6 Plus
Dwil\GK22984-PA 220 GK22984-PA 2..220 1..220 623 52.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11961-PA 222 GE11961-PA 2..222 1..221 1112 93.7 Plus
Dyak\GE11964-PA 222 GE11964-PA 3..221 2..221 758 63.2 Plus
Dyak\GE11965-PA 222 GE11965-PA 3..219 2..218 714 58.1 Plus
Dyak\GE11963-PA 222 GE11963-PA 3..219 2..218 691 56.7 Plus
Dyak\GE11962-PA 222 GE11962-PA 3..222 2..221 678 54.5 Plus

IP08243.hyp Sequence

Translation from 0 to 665

> IP08243.hyp
GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNP
QHTVPLLQDDDACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMH
FESGVIFESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHDF
VAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKELPYYEEA
NGKGAAQFVELLRSKNFTIVS*

IP08243.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
GstE4-PA 222 CG17525-PA 2..222 1..221 1146 100 Plus
GstE7-PA 223 CG17531-PA 3..222 2..221 724 63.3 Plus
GstE5-PA 222 CG17527-PA 3..222 2..221 702 57.7 Plus
GstE8-PB 222 CG17533-PB 3..219 2..218 702 59 Plus
GstE8-PA 222 CG17533-PA 3..219 2..218 702 59 Plus