Clone IP08245 Report

Search the DGRC for IP08245

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:82
Well:45
Vector:pOT2
Associated Gene/TranscriptCG17652-RA
Protein status:IP08245.pep: validated not full length
Preliminary Size:735
Sequenced Size:803

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17652 2005-01-01 Successful iPCR screen
CG17652 2008-04-29 Release 5.5 accounting
CG17652 2008-08-15 Release 5.9 accounting
CG17652 2008-12-18 5.12 accounting

Clone Sequence Records

IP08245.complete Sequence

803 bp (803 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022323

> IP08245.complete
AAAATATCTCGTTTTAAGAAGTCGCACAAAACTCTGGTGTTTTTTGCCAG
CAATTTCGACTACCGGGAACCCTACCAAGTGCTAATTGATGCCACCTTTT
GCCAAGCAGCCCTTCAGCAAAAGATTGGCATAGATGAGCAGATTAAAAAG
TACTTCCAGTGCGGCGTTAAGCTACTGACCACCCAGTGTGTTATTCTGGA
GTCGGAATCCCTGGGTGCTCCTCTCACTGGAGCCACATCCATCGTCAAGC
GATTCCATGTCCACAAATGCGGACACGAAGGAAAACCAGTCCCCGCTTCC
GAATGCATCAAATCGATGACCAAAGACAATCGCTATGTGGTTGCCTCGCA
AGATCGTCTGCTGCAGGAGAGTCTTCGCAAGATTCCCGGACGTTGTCTGC
TCTATCTGCACAAAGCCACTCCCGTCTTGGAAGCACCATCTAAAGCCTCC
AAGAAGTGGGTGCAACGACGGGCCAAAAACCTAATGCTGGGCAAACAGGT
CGAGAAAATCGACTACATGAAGGAGAAGCAGGGACTGAAGCCAGCTGAAA
CTGCAGTCAAACCCAAGAAGCACAAAGGGCCCAAGAACCCCAATCCATTG
TCCTGCAAGAAGAGCAAAAAGGACAAGGCGAAGCAACAGCTCAAAGGAGT
TGAGCAGACCGCAATAACCAAGGCGAAACGAAAACGAGTCAAGATCCCAG
CGCACGTCAAGGCAGCGCTAGGAAAAGATTAGATTAGAATGGTTGATCAA
GTAGATAAATATAAGATAATGCAAGGTAAAAAAAAAAAAAAAAAAAAAAA
AAA

IP08245.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG17652-RA 999 CG17652-RA 101..879 1..779 3895 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1731185..1731644 777..318 2285 99.8 Minus
chr2L 23010047 chr2L 1731707..1731909 318..116 1015 100 Minus
chr2L 23010047 chr2L 1731971..1732087 117..1 585 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1731356..1731817 779..318 2310 100 Minus
2L 23513712 2L 1731880..1732082 318..116 1015 100 Minus
2L 23513712 2L 1732144..1732260 117..1 585 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1731356..1731817 779..318 2310 100 Minus
2L 23513712 2L 1731880..1732082 318..116 1015 100 Minus
2L 23513712 2L 1732144..1732260 117..1 585 100 Minus
Blast to na_te.dros performed 2019-03-16 23:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 5346..5383 549..586 109 76.3 Plus

IP08245.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:41:07 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1731185..1731643 319..777 99 <- Minus
chr2L 1731707..1731907 118..318 100 <- Minus
chr2L 1731971..1732087 1..117 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:12 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
CG17652-RA 4..735 1..732 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:18:54 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
CG17652-RA 4..735 1..732 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:59 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
CG17652-RA 4..735 1..732 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:03:07 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
CG17652-RA 4..735 1..732 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:55:02 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
CG17652-RA 4..735 1..732 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:19:00 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
CG17652-RA 4..735 1..732 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:18:54 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
CG17652-RA 97..873 1..777 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:59 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
CG17652-RA 97..873 1..777 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:03:08 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
CG17652-RA 4..735 1..732 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:55:02 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
CG17652-RA 97..873 1..777 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:41:07 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1731358..1731816 319..777 100 <- Minus
2L 1731880..1732080 118..318 100 <- Minus
2L 1732144..1732260 1..117 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:41:07 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1731358..1731816 319..777 100 <- Minus
2L 1731880..1732080 118..318 100 <- Minus
2L 1732144..1732260 1..117 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:41:07 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1731358..1731816 319..777 100 <- Minus
2L 1731880..1732080 118..318 100 <- Minus
2L 1732144..1732260 1..117 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:59 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1731358..1731816 319..777 100 <- Minus
arm_2L 1731880..1732080 118..318 100 <- Minus
arm_2L 1732144..1732260 1..117 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:06 Download gff for IP08245.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1731358..1731816 319..777 100 <- Minus
2L 1731880..1732080 118..318 100 <- Minus
2L 1732144..1732260 1..117 100   Minus

IP08245.pep Sequence

Translation from 0 to 731

> IP08245.pep
KISRFKKSHKTLVFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKK
YFQCGVKLLTTQCVILESESLGAPLTGATSIVKRFHVHKCGHEGKPVPAS
ECIKSMTKDNRYVVASQDRLLQESLRKIPGRCLLYLHKATPVLEAPSKAS
KKWVQRRAKNLMLGKQVEKIDYMKEKQGLKPAETAVKPKKHKGPKNPNPL
SCKKSKKDKAKQQLKGVEQTAITKAKRKRVKIPAHVKAALGKD*

IP08245.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15875-PA 246 GF15875-PA 2..246 1..243 1162 90.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24578-PA 244 GG24578-PA 2..244 1..243 1242 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25024-PA 244 GH25024-PA 2..243 1..243 1053 82.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG17652-PB 244 CG17652-PB 2..244 1..243 1257 100 Plus
CG17652-PA 244 CG17652-PA 2..244 1..243 1257 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21388-PA 109 GI21388-PA 2..108 1..107 498 84.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18472-PA 244 GL18472-PA 2..244 1..243 1062 85.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14597-PA 244 GA14597-PA 2..244 1..243 1063 85.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16596-PA 244 GM16596-PA 2..244 1..243 1260 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22898-PA 244 GD22898-PA 2..244 1..243 1264 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17448-PA 242 GJ17448-PA 2..242 1..243 1050 84 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18467-PA 249 GK18467-PA 2..249 1..243 1104 84.3 Plus
Dwil\GK20199-PA 249 GK20199-PA 2..248 1..242 1098 84.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15456-PA 244 GE15456-PA 2..244 1..243 1255 98.4 Plus

IP08245.hyp Sequence

Translation from 0 to 731

> IP08245.hyp
KISRFKKSHKTLVFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKK
YFQCGVKLLTTQCVILESESLGAPLTGATSIVKRFHVHKCGHEGKPVPAS
ECIKSMTKDNRYVVASQDRLLQESLRKIPGRCLLYLHKATPVLEAPSKAS
KKWVQRRAKNLMLGKQVEKIDYMKEKQGLKPAETAVKPKKHKGPKNPNPL
SCKKSKKDKAKQQLKGVEQTAITKAKRKRVKIPAHVKAALGKD*

IP08245.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17652-PB 244 CG17652-PB 2..244 1..243 1257 100 Plus
CG17652-PA 244 CG17652-PA 2..244 1..243 1257 100 Plus