Clone IP08350 Report

Search the DGRC for IP08350

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:83
Well:50
Vector:pOT2
Associated Gene/TranscriptCG18132-RA
Protein status:IP08350.pep: gold
Preliminary Size:642
Sequenced Size:701

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18132 2005-01-01 Successful iPCR screen
CG18132 2008-04-29 Release 5.5 accounting
CG18132 2008-08-15 Release 5.9 accounting
CG18132 2008-12-18 5.12 accounting

Clone Sequence Records

IP08350.complete Sequence

701 bp (701 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022347

> IP08350.complete
TTGCGATCAAAAAAAGTTTGTTATGTAAAAATTGCCAAAAATGTCTACCT
TTCGGTGTATTTACTTTCTATTTTCACTATTGATCTGGAGTGCTCAATCG
GATAAATCTCTATCGAAACAGTCCGGAAATGTAACCACAATTACAAATTT
GAGTGTGAAGGCAAGATCCGCAGATCAGTGCACTCCTGGCACGATACTTA
AGCTGAGAGTGGACAATTTCTTCGAAACCACCGAAGATGGGACGTTCTTC
GTAAAGTTCTATGAGCCGAATTGCATGGGCTGCCACGATTTCGAAACTAC
CTGGACTGACATGGCCAAATCGTTCAAGTCGAAGGAAAACATTTGTTTTG
CTGAGCTCAATTGCAAGTTCGCAAAAACCATATGCAACGACTATGAGCTT
CGGTATGAACCAAACCTCATATGGCTGGAAAATGGGGAGGAAGTTCAGCA
GTACGACGGGGACTTGACTTCCCCTGGCATTAAAATATTCGTTTGGGAAA
TGATTAGGCGGAATGAAACCAACAAATCCGCCGCCAAAAGGCCATATTTT
CACACCAAGCCAATTATCCTCTTTGGATGGTTCCTCTATGCTGGGGATGT
GATTTCGTATTTTGCATAAATATCTCTAAATTATAGTCGTATTAGAAGCA
ATCAGTGTAGTAGTCTAAAATGCAAAATAATTATAAAAAAAAAAAAAAAA
A

IP08350.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG18132-RA 689 CG18132-RA 1..689 1..689 3445 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1516684..1517367 684..1 3420 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1516790..1517478 689..1 3445 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1516790..1517478 689..1 3445 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:50:39 has no hits.

IP08350.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:51:29 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1516684..1517367 1..684 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:24 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
CG18132-RA 1..579 41..619 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:43 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
CG18132-RA 1..579 41..619 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:40 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
CG18132-RA 1..579 41..619 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:11 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
CG18132-RA 1..579 41..619 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:09:23 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
CG18132-RA 1..579 41..619 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:11 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
CG18132-RA 1..684 1..684 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:43 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
CG18132-RA 1..684 1..684 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:40 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
CG18132-RA 1..684 1..684 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:11 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
CG18132-RA 1..684 1..684 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:09:23 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
CG18132-RA 1..684 1..684 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:29 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1516795..1517478 1..684 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:29 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1516795..1517478 1..684 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:29 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1516795..1517478 1..684 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:40 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1516795..1517478 1..684 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:41 Download gff for IP08350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1516795..1517478 1..684 100   Minus

IP08350.pep Sequence

Translation from 40 to 618

> IP08350.pep
MSTFRCIYFLFSLLIWSAQSDKSLSKQSGNVTTITNLSVKARSADQCTPG
TILKLRVDNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKEN
ICFAELNCKFAKTICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIF
VWEMIRRNETNKSAAKRPYFHTKPIILFGWFLYAGDVISYFA*

IP08350.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19652-PA 188 GF19652-PA 10..183 9..183 271 33.5 Plus
Dana\GF20267-PA 413 GF20267-PA 168..301 50..176 194 28.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24589-PA 192 GG24589-PA 1..191 1..191 823 78.5 Plus
Dere\GG18439-PA 418 GG18439-PA 157..273 39..155 190 29.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24386-PA 409 GH24386-PA 167..272 50..155 184 29.2 Plus
Dgri\GH24386-PA 409 GH24386-PA 296..408 51..159 152 30.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG18132-PA 192 CG18132-PA 1..192 1..192 1041 100 Plus
prtp-PD 353 CG1837-PD 92..208 39..155 200 29.1 Plus
prtp-PC 416 CG1837-PC 155..271 39..155 200 29.1 Plus
prtp-PB 416 CG1837-PB 155..271 39..155 200 29.1 Plus
prtp-PA 416 CG1837-PA 155..271 39..155 200 29.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17626-PA 287 GI17626-PA 146..238 47..140 211 37.2 Plus
Dmoj\GI15325-PA 406 GI15325-PA 167..278 50..161 188 31.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15145-PA 387 GL15145-PA 152..278 19..155 212 27 Plus
Dper\GL14774-PA 421 GL14774-PA 238..385 19..160 189 28.9 Plus
Dper\GL14774-PA 421 GL14774-PA 24..142 44..159 170 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14908-PA 421 GA14908-PA 152..278 19..155 212 27 Plus
Dpse\GA25286-PA 371 GA25286-PA 238..358 19..132 170 28.1 Plus
Dpse\GA25286-PA 371 GA25286-PA 24..142 44..159 163 30.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16606-PA 192 GM16606-PA 1..192 1..192 924 89.1 Plus
Dsec\GM13104-PA 416 GM13104-PA 155..271 39..155 195 29.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22906-PA 114 GD22906-PA 1..114 79..192 598 95.6 Plus
Dsim\GD17042-PA 416 GD17042-PA 155..271 39..155 195 29.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17540-PA 275 GJ17540-PA 125..245 42..165 241 35.5 Plus
Dvir\GJ14762-PA 410 GJ14762-PA 168..273 50..155 180 29.2 Plus
Dvir\GJ14762-PA 410 GJ14762-PA 298..409 52..159 157 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25489-PA 415 GK25489-PA 167..271 50..154 203 31.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15566-PA 192 GE15566-PA 1..191 1..191 806 78 Plus
Dyak\GE15661-PA 412 GE15661-PA 162..267 50..155 195 30.2 Plus

IP08350.hyp Sequence

Translation from 40 to 618

> IP08350.hyp
MSTFRCIYFLFSLLIWSAQSDKSLSKQSGNVTTITNLSVKARSADQCTPG
TILKLRVDNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKEN
ICFAELNCKFAKTICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIF
VWEMIRRNETNKSAAKRPYFHTKPIILFGWFLYAGDVISYFA*

IP08350.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG18132-PA 192 CG18132-PA 1..192 1..192 1041 100 Plus
prtp-PD 353 CG1837-PD 92..208 39..155 200 29.1 Plus
prtp-PC 416 CG1837-PC 155..271 39..155 200 29.1 Plus
prtp-PB 416 CG1837-PB 155..271 39..155 200 29.1 Plus
prtp-PA 416 CG1837-PA 155..271 39..155 200 29.1 Plus