Clone IP08357 Report

Search the DGRC for IP08357

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:83
Well:57
Vector:pOT2
Associated Gene/TranscriptCG18662-RA
Protein status:IP08357.pep: gold
Preliminary Size:630
Sequenced Size:972

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18662 2005-01-01 Successful iPCR screen
CG18662 2008-04-29 Release 5.5 accounting
CG18662 2008-08-15 Release 5.9 accounting
CG18662 2008-12-18 5.12 accounting

Clone Sequence Records

IP08357.complete Sequence

972 bp (972 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022351

> IP08357.complete
CTGAGAAGGCCCTGCCCATTATCAAGAAGCGCAAGCAGAACATAGGAGGT
GATCTCGACGTCGTTACTGCGAGGTTTCCAGTGGAAAACTCGTCCATCCT
CACCAGTCGATTCCGTGGCCTTGGACCACCACATTCGATCGTTTTCCTTT
CGGGCCACGCTCTCCAGCTTAGCAATGACCTTCTCCGACTGCGGGTGCTT
GGCCAGTTGGAGGGCCACGGCGGCAATGGCCAGGGAATACTGGTCGTCCG
TCTTGTCAGCCTCTTCGGCCACATAGCGTACTGCTTTCTTAATGGCACTT
TGGTACTTCGGGATCAGTTCGACAGCTAGTACACAAATAAAAAGAAAAAA
AGCAAAAATATTTTTTTTTTTTGACATGGAGTTTGCTGGAAAATTTCTTA
AACCCGTTTGGCGGCCAATGATGCAAGCGGCTCGACTTTATTGTGAGAAG
CCAATGCGAAGTCTAGTCGCTTTTCCTGTTGCCAAGGTGGAAAGTGGAAA
ATCAAAGTACATGATGGCCCACGTTTATATCCATGGGGAAATGGGTAGCG
CCAAGCAGGTGATTCGTAGCCTTTCCAAGGCCAAGTACCATCTTGATGTA
TACGATGAGTTGAAAAAGGAGGCTGAGTCGATGGGCTTGTGCACCCAGGG
TCTTGGAGGTGGTTACTTGGTTCACGACAAGGAAAAGAAGTACATCAAGC
TGTATGGAAGATCACAGGCCCTGGGAAAAGCTGATCACGAAGCTGCCCGT
GAGATATTGCAACCCATCTATACCGATCACAAGATCGATGCCGAATCTGG
TGGAATGGAGCCCTAGAAGGATGTGTACTGACCAATATTTCTGTTTTAAG
AAACACTCACTATTGGCTCGACATATTTTTTACAAATTTTGGTCTTACGA
CTGTGTGCGCATTGCTTACGTAAATTTGAATTAAATTTGACTATACGTAA
AAAAAAAAAAAAAAAAAAAAAA

IP08357.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG18662-RA 741 CG18662-RA 61..691 319..950 3120 99.8 Plus
TepII-RE 4439 TepII-RE 3243..3541 320..22 1495 100 Minus
TepII-RC 4466 TepII-RC 3270..3568 320..22 1495 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8979997..8980352 593..948 1705 98.6 Plus
chr2L 23010047 chr2L 7693793..7694091 22..320 1480 99.7 Plus
chr2L 23010047 chr2L 8979773..8979943 426..596 765 96.5 Plus
chr2L 23010047 chr2L 8979596..8979703 319..427 480 98.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8981077..8981434 593..950 1790 100 Plus
2L 23513712 2L 7694698..7694996 22..320 1495 100 Plus
2L 23513712 2L 8980853..8981023 426..596 840 99.4 Plus
2L 23513712 2L 8980676..8980783 319..427 495 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8981077..8981434 593..950 1790 100 Plus
2L 23513712 2L 7694698..7694996 22..320 1495 100 Plus
2L 23513712 2L 8980853..8981023 426..596 840 99.4 Plus
2L 23513712 2L 8980676..8980783 319..427 505 99 Plus
Blast to na_te.dros performed on 2019-03-16 06:03:50 has no hits.

IP08357.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:04:34 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8979587..8979703 308..427 95 -> Plus
chr2L 8979775..8979939 428..592 96 -> Plus
chr2L 8979997..8980352 593..948 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:25 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
CG18662-RA 1..441 376..816 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:19:01 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
CG18662-RA 1..441 376..816 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:04:01 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
CG18662-RA 1..441 376..816 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:03:15 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
CG18662-RA 1..441 376..816 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:11:26 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
CG18662-RA 1..441 376..816 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:19:09 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
CG18662-RA 1..625 323..948 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:19:01 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
CG18662-RA 1..625 323..948 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:01 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
CG18662-RA 9..646 308..948 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:03:15 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
CG18662-RA 1..625 323..948 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:11:26 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
CG18662-RA 9..646 308..948 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:34 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8980667..8980783 308..427 95 -> Plus
2L 8980855..8981019 428..592 100 -> Plus
2L 8981077..8981432 593..948 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:34 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8980667..8980783 308..427 95 -> Plus
2L 8980855..8981019 428..592 100 -> Plus
2L 8981077..8981432 593..948 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:34 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8980667..8980783 308..427 95 -> Plus
2L 8980855..8981019 428..592 100 -> Plus
2L 8981077..8981432 593..948 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:01 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8980667..8980783 308..427 95 -> Plus
arm_2L 8980855..8981019 428..592 100 -> Plus
arm_2L 8981077..8981432 593..948 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:13 Download gff for IP08357.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8981077..8981432 593..948 100   Plus
2L 8980855..8981019 428..592 100 -> Plus
2L 8980667..8980783 308..427 95 -> Plus

IP08357.pep Sequence

Translation from 291 to 815

> IP08357.pep
MALWYFGISSTASTQIKRKKAKIFFFFDMEFAGKFLKPVWRPMMQAARLY
CEKPMRSLVAFPVAKVESGKSKYMMAHVYIHGEMGSAKQVIRSLSKAKYH
LDVYDELKKEAESMGLCTQGLGGGYLVHDKEKKYIKLYGRSQALGKADHE
AAREILQPIYTDHKIDAESGGMEP*

IP08357.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22681-PA 146 GF22681-PA 1..146 29..174 588 71.9 Plus
Dana\GF19996-PA 115 GF19996-PA 2..112 56..165 211 39.3 Plus
Dana\GF23242-PA 145 GF23242-PA 5..127 34..156 183 27.4 Plus
Dana\GF23241-PA 126 GF23241-PA 4..120 56..173 170 32.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25321-PA 146 GG25321-PA 1..146 29..174 744 95.2 Plus
Dere\janB-PA 140 GG11971-PA 27..140 57..169 207 33 Plus
Dere\janA-PA 119 GG11970-PA 5..118 57..171 178 34.5 Plus
Dere\ocn-PA 149 GG11972-PA 5..126 34..156 159 29.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25086-PA 134 GH25086-PA 1..133 44..173 350 51.9 Plus
Dgri\GH18402-PA 144 GH18402-PA 17..129 43..156 235 37.7 Plus
Dgri\GH18401-PA 122 GH18401-PA 4..121 56..171 197 36.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG18662-PA 146 CG18662-PA 1..146 29..174 765 100 Plus
janB-PA 140 CG7931-PA 27..136 57..165 198 36.9 Plus
janA-PB 135 CG7933-PB 7..134 43..171 191 32.3 Plus
janA-PA 119 CG7933-PA 5..118 57..171 188 34.5 Plus
janA-PC 119 CG7933-PC 5..118 57..171 188 34.5 Plus
ocn-PA 148 CG7929-PA 7..126 36..156 187 28.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17452-PA 148 GI17452-PA 1..147 29..173 440 53.7 Plus
Dmoj\GI23391-PA 123 GI23391-PA 4..122 56..171 206 38.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26233-PA 149 GL26233-PA 1..149 29..174 446 55.7 Plus
Dper\GL20557-PA 140 GL20557-PA 2..125 22..156 195 32.6 Plus
Dper\GL13482-PA 124 GL13482-PA 4..123 56..171 162 31.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15041-PA 149 GA15041-PA 1..149 29..174 443 55 Plus
Dpse\GA20697-PB 140 GA20697-PB 24..125 54..156 190 35.9 Plus
Dpse\janA-PB 149 GA20699-PB 17..148 44..171 170 31.1 Plus
Dpse\janA-PA 124 GA20699-PA 4..123 56..171 162 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17315-PA 146 GM17315-PA 1..146 29..174 759 97.9 Plus
Dsec\janB-PA 140 GM12188-PA 27..139 57..168 203 34.2 Plus
Dsec\ocn-PA 148 GM12189-PA 29..126 58..156 183 31.3 Plus
Dsec\janA-PA 119 GM12187-PA 5..118 57..171 171 33.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23579-PA 146 GD23579-PA 1..146 29..174 759 97.9 Plus
Dsim\janB-PA 138 GD17410-PA 25..137 57..168 200 33.3 Plus
Dsim\ocn-PA 148 GD17421-PA 29..126 58..156 183 31.3 Plus
Dsim\janA-PA 119 GD17399-PA 5..118 57..171 171 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14340-PA 149 GJ14340-PA 1..148 29..173 459 56.1 Plus
Dvir\GJ10386-PA 122 GJ10386-PA 4..121 56..171 198 37.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15329-PA 146 GK15329-PA 5..145 33..173 466 60.3 Plus
Dwil\GK13426-PA 118 GK13426-PA 6..104 58..157 190 35 Plus
Dwil\GK13425-PA 124 GK13425-PA 39..123 87..171 176 38.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18815-PA 146 GE18815-PA 1..146 29..174 732 93.8 Plus
Dyak\janB-PA 138 GE23420-PA 25..138 57..169 201 33 Plus
Dyak\ocn-PA 149 GE23422-PA 5..126 34..156 195 30.1 Plus
Dyak\janA-PA 119 GE23419-PA 5..118 57..171 175 33.6 Plus

IP08357.hyp Sequence

Translation from 375 to 815

> IP08357.hyp
MEFAGKFLKPVWRPMMQAARLYCEKPMRSLVAFPVAKVESGKSKYMMAHV
YIHGEMGSAKQVIRSLSKAKYHLDVYDELKKEAESMGLCTQGLGGGYLVH
DKEKKYIKLYGRSQALGKADHEAAREILQPIYTDHKIDAESGGMEP*

IP08357.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG18662-PA 146 CG18662-PA 1..146 1..146 765 100 Plus
janB-PA 140 CG7931-PA 27..136 29..137 198 36.9 Plus
janA-PB 135 CG7933-PB 7..134 15..143 191 32.3 Plus
janA-PA 119 CG7933-PA 5..118 29..143 188 34.5 Plus
janA-PC 119 CG7933-PC 5..118 29..143 188 34.5 Plus