Clone IP08359 Report

Search the DGRC for IP08359

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:83
Well:59
Vector:pOT2
Associated Gene/TranscriptCG1946-RA
Protein status:IP08359.pep: gold
Preliminary Size:700
Sequenced Size:1190

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1946-RA 2009-01-21 est gleaning

Clone Sequence Records

IP08359.complete Sequence

1190 bp assembled on 2009-06-16

GenBank Submission: BT088826.1

> IP08359.complete
TCGAAATAGTCGCTTCTTGTGTTGAAGATCGGTCTAATTGAGCATGACAA
TCGAATGGGCTCCTCTCCGGGTTCCGCTGGAACGGCGGCTTCAGACCCTG
GTTACGTCATTCTTCACCTATACCTTCTTTACGCTGCCCATCTCGTCCTG
CCTCGCAGTAGCTATCCTGCTGTACTACGGCGAAATGTTTGTGCGTAGTC
TGCTTCTTATCTATTTTGTGAAAATTTATTTGGATTATAAAAGAAATTAC
GGCATTATGGAAGGTAATGGTTGGTTATTCTACCGCAGCAATTGGAGATA
TCGAAACTACTTCCCCGTCGAACTTGTAAAAACCGCCGAGCTGCCTCCCA
ACAGGAACTATATCGTAGCAAGCTTTCCACACGGAATACTTGGTACTGGA
ACTTGCATTAACATGAGCCTGGACATCGACAATTGGCTATCCCTTTACCC
GCACGTTCGACCCAAGATCGCCACCCTGGATCATCACTTCAAGACGCCTT
TCCTGCGTGACATATTGCGCTGGTGGGGCATGGTATCGGTTTCCAAGGAA
TCCCTGTCCTATTTACTCAGCAAGTCAAATGATCCAATGCACAAGGATAA
TCGGGATGGTTTCACATCCAATGCGGTGGCCGTACTTGTTGGTGGCGCCA
AGGAAGCCATGGATTCGCATCCGGGACAGTACATTTTGACCCTCAAGGAT
AGAAAGGGTTTCGTCAAAATGGCTGTTCGAACCGGATCGTCGATTGTGCC
CTCGTTGTCCTTTGGCGAGGTGGACATATTTGATCAGGTGGCTAATCCTC
CGGACTCCTCGCTCCGTCGCTTCCAGAATGTGGTCAAGAAATTCACAGGC
ATTTCACCGCTCCTTCCCAAGGGTCGCGGTATCTTCAACTACAACTATGG
CATTCTCCCACATCGACGACGTATTGTCCAAGTTGTTGGTTCCCCCATCG
ATGTGGAAAGATGCGAGACTCCCGATCCCGAATATGTGGACAAGATCCAT
GGGCAGGTGATCGACGCGCTGGCGAGGATGTTCGATGAATACAAAGAGAA
GTACACTCCAAACTCAAAGCATATCAAACTTATAATACAGTGACTCAGTA
GAGTCCCTTAGATTGTGATTTTTTATAGAATTAAGGAAACTTTTGAAACG
CAACACAGTTTTAGACTAATTTAAAAAAAAAAAAAAAAAA

IP08359.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG1946-RA 1340 CG1946-RA 130..1311 1..1182 5910 100 Plus
CG1942-RA 1441 CG1942-RA 803..1191 566..954 820 80.7 Plus
CG1941-RA 1444 CG1941-RA 665..1050 571..956 505 75.3 Plus
CG1942-RA 1441 CG1942-RA 545..783 308..546 205 72.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3603196..3603538 393..735 1700 99.7 Plus
chr2R 21145070 chr2R 3603862..3604099 935..1172 1145 98.7 Plus
chr2R 21145070 chr2R 3603596..3603796 735..935 1005 100 Plus
chr2R 21145070 chr2R 3602258..3602429 1..172 860 100 Plus
chr2R 21145070 chr2R 3603018..3603141 270..393 605 99.2 Plus
chr2R 21145070 chr2R 3600634..3600943 405..714 500 77.4 Plus
chr2R 21145070 chr2R 3602849..3602947 172..270 495 100 Plus
chr2R 21145070 chr2R 3601026..3601221 740..935 305 77 Plus
chr2R 21145070 chr2R 3598394..3598722 395..723 295 72.6 Plus
chr2R 21145070 chr2R 3598799..3598994 740..935 260 75.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7715878..7716220 393..735 1715 100 Plus
2R 25286936 2R 7716544..7716791 935..1182 1240 100 Plus
2R 25286936 2R 7716278..7716478 735..935 1005 100 Plus
2R 25286936 2R 7714940..7715111 1..172 860 100 Plus
2R 25286936 2R 7715700..7715823 270..393 620 100 Plus
2R 25286936 2R 7715531..7715629 172..270 495 100 Plus
2R 25286936 2R 7713316..7713625 405..714 485 77.1 Plus
2R 25286936 2R 7713708..7713903 740..935 320 77.6 Plus
2R 25286936 2R 7711076..7711404 395..723 295 72.6 Plus
2R 25286936 2R 7711481..7711676 740..935 260 75.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7717077..7717419 393..735 1715 100 Plus
2R 25260384 2R 7717743..7717990 935..1182 1240 100 Plus
2R 25260384 2R 7717477..7717677 735..935 1005 100 Plus
2R 25260384 2R 7716139..7716310 1..172 860 100 Plus
2R 25260384 2R 7716899..7717022 270..393 620 100 Plus
2R 25260384 2R 7716730..7716828 172..270 495 100 Plus
2R 25260384 2R 7714676..7714824 566..714 445 86.5 Plus
2R 25260384 2R 7714907..7715102 740..935 320 77.5 Plus
2R 25260384 2R 7712680..7712747 740..807 190 85.2 Plus
Blast to na_te.dros performed on 2019-03-16 18:23:45 has no hits.

IP08359.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:24:38 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3602258..3602429 1..172 100 -> Plus
chr2R 3602850..3602947 173..270 100 -> Plus
chr2R 3603019..3603141 271..393 99 -> Plus
chr2R 3603197..3603538 394..735 99 -> Plus
chr2R 3603597..3603796 736..935 100 -> Plus
chr2R 3603863..3604099 936..1172 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:36 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
CG1946-RA 1..1050 44..1093 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:48:02 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
CG1946-RA 1..1050 44..1093 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:16 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
CG1946-RA 1..1050 44..1093 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:39:07 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
CG1946-RA 1..1050 44..1093 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-16 14:40:52 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
CG1946-RA 1..1129 44..1172 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:48:02 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
CG1946-RA 1..1129 44..1172 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:16 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
CG1946-RA 18..1189 1..1172 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:39:07 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
CG1946-RA 18..1189 1..1172 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:24:38 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7714940..7715111 1..172 100 -> Plus
2R 7715532..7715629 173..270 100 -> Plus
2R 7715701..7715823 271..393 100 -> Plus
2R 7715879..7716220 394..735 100 -> Plus
2R 7716279..7716478 736..935 100 -> Plus
2R 7716545..7716781 936..1172 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:24:38 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7714940..7715111 1..172 100 -> Plus
2R 7715532..7715629 173..270 100 -> Plus
2R 7715701..7715823 271..393 100 -> Plus
2R 7715879..7716220 394..735 100 -> Plus
2R 7716279..7716478 736..935 100 -> Plus
2R 7716545..7716781 936..1172 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:24:38 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7714940..7715111 1..172 100 -> Plus
2R 7715532..7715629 173..270 100 -> Plus
2R 7715701..7715823 271..393 100 -> Plus
2R 7715879..7716220 394..735 100 -> Plus
2R 7716279..7716478 736..935 100 -> Plus
2R 7716545..7716781 936..1172 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:16 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3602445..3602616 1..172 100 -> Plus
arm_2R 3603037..3603134 173..270 100 -> Plus
arm_2R 3603206..3603328 271..393 100 -> Plus
arm_2R 3603384..3603725 394..735 100 -> Plus
arm_2R 3603784..3603983 736..935 100 -> Plus
arm_2R 3604050..3604286 936..1172 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:23:34 Download gff for IP08359.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7717078..7717419 394..735 100 -> Plus
2R 7717478..7717677 736..935 100 -> Plus
2R 7717744..7717980 936..1172 100   Plus
2R 7716139..7716310 1..172 100 -> Plus
2R 7716731..7716828 173..270 100 -> Plus
2R 7716900..7717022 271..393 100 -> Plus

IP08359.pep Sequence

Translation from 43 to 1092

> IP08359.pep
MTIEWAPLRVPLERRLQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFV
RSLLLIYFVKIYLDYKRNYGIMEGNGWLFYRSNWRYRNYFPVELVKTAEL
PPNRNYIVASFPHGILGTGTCINMSLDIDNWLSLYPHVRPKIATLDHHFK
TPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVG
GAKEAMDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVA
NPPDSSLRRFQNVVKKFTGISPLLPKGRGIFNYNYGILPHRRRIVQVVGS
PIDVERCETPDPEYVDKIHGQVIDALARMFDEYKEKYTPNSKHIKLIIQ*

IP08359.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13199-PA 351 GF13199-PA 1..351 1..349 1313 70.1 Plus
Dana\GF13197-PA 352 GF13197-PA 1..352 1..349 1280 65.6 Plus
Dana\GF13198-PA 352 GF13198-PA 1..352 1..349 1249 67.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23300-PA 349 GG23300-PA 1..349 1..349 1682 92 Plus
Dere\GG23299-PA 352 GG23299-PA 1..352 1..349 1275 65.6 Plus
Dere\GG23298-PA 352 GG23298-PA 1..352 1..349 1271 65.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20316-PA 352 GH20316-PA 1..352 1..349 1262 67.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG1946-PA 349 CG1946-PA 1..349 1..349 1850 100 Plus
Dgat2-PA 352 CG1942-PA 1..351 1..348 1255 67.2 Plus
CG1941-PD 352 CG1941-PD 1..351 1..348 1254 66.7 Plus
CG1941-PC 352 CG1941-PC 1..351 1..348 1254 66.7 Plus
CG1941-PB 352 CG1941-PB 1..351 1..348 1254 66.7 Plus
CG1941-PA 352 CG1941-PA 1..351 1..348 1254 66.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19988-PA 352 GI19988-PA 1..352 1..349 1152 61.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10836-PA 352 GL10836-PA 1..352 1..349 1401 72.4 Plus
Dper\GL10526-PA 352 GL10526-PA 1..352 1..349 1325 68.2 Plus
Dper\GL10527-PA 352 GL10527-PA 1..352 1..349 1260 65.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15142-PA 352 GA15142-PA 1..352 1..349 1404 72.7 Plus
Dpse\GA15143-PA 352 GA15143-PA 1..352 1..349 1318 67.6 Plus
Dpse\GA24395-PA 352 GA24395-PA 1..352 1..349 1260 65.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20978-PA 349 GM20978-PA 1..349 1..349 1707 95.1 Plus
Dsec\GM20976-PA 352 GM20976-PA 1..352 1..349 1281 65.9 Plus
Dsec\GM20977-PA 352 GM20977-PA 1..352 1..349 1269 65.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15355-PA 349 GD15355-PA 1..349 1..349 1720 96 Plus
Dsim\GD10506-PA 349 GD10506-PA 1..349 1..349 1709 95.4 Plus
Dsim\GD10505-PA 352 GD10505-PA 1..352 1..349 1288 66.8 Plus
Dsim\GD10504-PA 352 GD10504-PA 1..352 1..349 1270 65.6 Plus
Dsim\GD15354-PA 253 GD15354-PA 1..251 1..258 868 62.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21238-PA 352 GJ21238-PA 1..352 1..349 1345 69.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21715-PA 352 GK21715-PA 1..352 1..349 1367 69.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19146-PA 349 GE19146-PA 1..349 1..349 1674 92.3 Plus
Dyak\GE19145-PA 352 GE19145-PA 1..352 1..349 1293 67 Plus
Dyak\GE19144-PA 352 GE19144-PA 1..352 1..349 1273 65.9 Plus

IP08359.hyp Sequence

Translation from 43 to 1092

> IP08359.hyp
MTIEWAPLRVPLERRLQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFV
RSLLLIYFVKIYLDYKRNYGIMEGNGWLFYRSNWRYRNYFPVELVKTAEL
PPNRNYIVASFPHGILGTGTCINMSLDIDNWLSLYPHVRPKIATLDHHFK
TPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTSNAVAVLVG
GAKEAMDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVA
NPPDSSLRRFQNVVKKFTGISPLLPKGRGIFNYNYGILPHRRRIVQVVGS
PIDVERCETPDPEYVDKIHGQVIDALARMFDEYKEKYTPNSKHIKLIIQ*

IP08359.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG1946-PA 349 CG1946-PA 1..349 1..349 1850 100 Plus
CG1942-PA 352 CG1942-PA 1..351 1..348 1255 67.2 Plus
CG1941-PD 352 CG1941-PD 1..351 1..348 1254 66.7 Plus
CG1941-PC 352 CG1941-PC 1..351 1..348 1254 66.7 Plus
CG1941-PB 352 CG1941-PB 1..351 1..348 1254 66.7 Plus