BDGP Sequence Production Resources |
Search the DGRC for IP08371
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 83 |
Well: | 71 |
Vector: | pOT2 |
Associated Gene/Transcript | CG30324-RA |
Protein status: | IP08371.pep: gold |
Preliminary Size: | 646 |
Sequenced Size: | 625 |
Gene | Date | Evidence |
---|---|---|
CG30324 | 2005-01-01 | Successful iPCR screen |
CG30324 | 2008-04-29 | Release 5.5 accounting |
CG30324 | 2008-08-15 | Release 5.9 accounting |
CG30324 | 2008-12-18 | 5.12 accounting |
625 bp (625 high quality bases) assembled on 2006-09-22
GenBank Submission: BT029070
> IP08371.complete CCAAATCGTTCGTACCTTTCCGATTTGAACCCCACTCTTTCCACAATGTT TTCCGATCCCGCCCAGGAGTCGGTTGCCACGCAGACGGAGGCACAACCGG TTCCGTCGCCCATCTGCACCCCACTGCTGATGGTGGACGAGGATGGACGA AAGCGGTACTGCTACCATGGTGGAAAATGCAAGTGTGCCACTTGCGCACA AATTCGTGCAGAGCAGGCAGTGAAACTCGACCAGGAGCTGCTGTCCTACA TACCGCACTCGAAGCTCCACCTGGAAGTTCCAATCCGAATGGCCAAGCCG AAGCAGTATCGCCTGGAAGCTCGACGGGCTACTCCCGAACTGGCAAAATT TCTGCGGGAGGATCACGAGAGGCTGAGGGCGGAGTATCCATCGTACTATC TCCCGGATCGATACTTTGGTAAGAAATTCTACGAGTTGCCAGGACCGCAG CACAAGGAGACCCAGACGGACATTCCGATTGGGCGTTACGGCATCGATGG TTGTCCCTGTACCAATAAATCGCTCTGCTATGACTTGTAATCCTGGGCAG GACTCAATTGGGGAAAAAAGAGTTTAATAAAAGTTCGGAATGTGAGAAGT AAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30324-RA | 648 | CG30324-RA | 49..648 | 1..600 | 3000 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 12174939..12175538 | 600..1 | 2910 | 99 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 16287585..16288185 | 601..1 | 3005 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 16288784..16289384 | 601..1 | 3005 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 12174939..12175538 | 1..600 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30324-RA | 1..495 | 46..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30324-RA | 1..495 | 46..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30324-RA | 1..495 | 46..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30324-RA | 1..495 | 46..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30324-RA | 1..495 | 46..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30324-RA | 49..646 | 1..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30324-RA | 49..648 | 1..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30324-RA | 49..648 | 1..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30324-RA | 49..646 | 1..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30324-RA | 49..648 | 1..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16287586..16288185 | 1..600 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16287586..16288185 | 1..600 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16287586..16288185 | 1..600 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 12175091..12175690 | 1..600 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16288785..16289384 | 1..600 | 100 | Minus |
Translation from 0 to 539
> IP08371.hyp PNRSYLSDLNPTLSTMFSDPAQESVATQTEAQPVPSPICTPLLMVDEDGR KRYCYHGGKCKCATCAQIRAEQAVKLDQELLSYIPHSKLHLEVPIRMAKP KQYRLEARRATPELAKFLREDHERLRAEYPSYYLPDRYFGKKFYELPGPQ HKETQTDIPIGRYGIDGCPCTNKSLCYDL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30324-PA | 164 | CG30324-PA | 1..164 | 16..179 | 895 | 100 | Plus |
Translation from 45 to 539
> IP08371.pep MFSDPAQESVATQTEAQPVPSPICTPLLMVDEDGRKRYCYHGGKCKCATC AQIRAEQAVKLDQELLSYIPHSKLHLEVPIRMAKPKQYRLEARRATPELA KFLREDHERLRAEYPSYYLPDRYFGKKFYELPGPQHKETQTDIPIGRYGI DGCPCTNKSLCYDL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11273-PA | 164 | GF11273-PA | 1..164 | 1..164 | 698 | 79.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22280-PA | 164 | GG22280-PA | 1..164 | 1..164 | 834 | 94.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22110-PA | 164 | GH22110-PA | 1..164 | 1..164 | 441 | 51.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30324-PA | 164 | CG30324-PA | 1..164 | 1..164 | 895 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20289-PA | 165 | GI20289-PA | 2..165 | 1..164 | 482 | 53 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11353-PA | 164 | GL11353-PA | 1..164 | 1..164 | 556 | 60.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15762-PA | 164 | GA15762-PA | 1..164 | 1..164 | 562 | 61 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20068-PA | 164 | GM20068-PA | 1..164 | 1..164 | 847 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25549-PA | 164 | GD25549-PA | 1..164 | 1..164 | 846 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22017-PA | 164 | GJ22017-PA | 1..164 | 1..164 | 503 | 54.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19317-PA | 165 | GK19317-PA | 1..165 | 1..164 | 483 | 54.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14075-PA | 164 | GE14075-PA | 1..164 | 1..164 | 819 | 92.7 | Plus |