Clone IP08371 Report

Search the DGRC for IP08371

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:83
Well:71
Vector:pOT2
Associated Gene/TranscriptCG30324-RA
Protein status:IP08371.pep: gold
Preliminary Size:646
Sequenced Size:625

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30324 2005-01-01 Successful iPCR screen
CG30324 2008-04-29 Release 5.5 accounting
CG30324 2008-08-15 Release 5.9 accounting
CG30324 2008-12-18 5.12 accounting

Clone Sequence Records

IP08371.complete Sequence

625 bp (625 high quality bases) assembled on 2006-09-22

GenBank Submission: BT029070

> IP08371.complete
CCAAATCGTTCGTACCTTTCCGATTTGAACCCCACTCTTTCCACAATGTT
TTCCGATCCCGCCCAGGAGTCGGTTGCCACGCAGACGGAGGCACAACCGG
TTCCGTCGCCCATCTGCACCCCACTGCTGATGGTGGACGAGGATGGACGA
AAGCGGTACTGCTACCATGGTGGAAAATGCAAGTGTGCCACTTGCGCACA
AATTCGTGCAGAGCAGGCAGTGAAACTCGACCAGGAGCTGCTGTCCTACA
TACCGCACTCGAAGCTCCACCTGGAAGTTCCAATCCGAATGGCCAAGCCG
AAGCAGTATCGCCTGGAAGCTCGACGGGCTACTCCCGAACTGGCAAAATT
TCTGCGGGAGGATCACGAGAGGCTGAGGGCGGAGTATCCATCGTACTATC
TCCCGGATCGATACTTTGGTAAGAAATTCTACGAGTTGCCAGGACCGCAG
CACAAGGAGACCCAGACGGACATTCCGATTGGGCGTTACGGCATCGATGG
TTGTCCCTGTACCAATAAATCGCTCTGCTATGACTTGTAATCCTGGGCAG
GACTCAATTGGGGAAAAAAGAGTTTAATAAAAGTTCGGAATGTGAGAAGT
AAAAAAAAAAAAAAAAAAAAAAAAA

IP08371.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG30324-RA 648 CG30324-RA 49..648 1..600 3000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12174939..12175538 600..1 2910 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16287585..16288185 601..1 3005 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16288784..16289384 601..1 3005 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:33:26 has no hits.

IP08371.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:34:38 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12174939..12175538 1..600 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:28 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
CG30324-RA 1..495 46..540 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:26:00 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
CG30324-RA 1..495 46..540 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:30 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
CG30324-RA 1..495 46..540 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:45:45 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
CG30324-RA 1..495 46..540 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:33:06 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
CG30324-RA 1..495 46..540 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:54:24 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
CG30324-RA 49..646 1..598 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:25:59 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
CG30324-RA 49..648 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:30 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
CG30324-RA 49..648 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:45:46 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
CG30324-RA 49..646 1..598 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:06 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
CG30324-RA 49..648 1..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:34:38 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16287586..16288185 1..600 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:34:38 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16287586..16288185 1..600 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:34:38 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16287586..16288185 1..600 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:30 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12175091..12175690 1..600 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:53:00 Download gff for IP08371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16288785..16289384 1..600 100   Minus

IP08371.hyp Sequence

Translation from 0 to 539

> IP08371.hyp
PNRSYLSDLNPTLSTMFSDPAQESVATQTEAQPVPSPICTPLLMVDEDGR
KRYCYHGGKCKCATCAQIRAEQAVKLDQELLSYIPHSKLHLEVPIRMAKP
KQYRLEARRATPELAKFLREDHERLRAEYPSYYLPDRYFGKKFYELPGPQ
HKETQTDIPIGRYGIDGCPCTNKSLCYDL*

IP08371.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG30324-PA 164 CG30324-PA 1..164 16..179 895 100 Plus

IP08371.pep Sequence

Translation from 45 to 539

> IP08371.pep
MFSDPAQESVATQTEAQPVPSPICTPLLMVDEDGRKRYCYHGGKCKCATC
AQIRAEQAVKLDQELLSYIPHSKLHLEVPIRMAKPKQYRLEARRATPELA
KFLREDHERLRAEYPSYYLPDRYFGKKFYELPGPQHKETQTDIPIGRYGI
DGCPCTNKSLCYDL*

IP08371.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11273-PA 164 GF11273-PA 1..164 1..164 698 79.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22280-PA 164 GG22280-PA 1..164 1..164 834 94.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22110-PA 164 GH22110-PA 1..164 1..164 441 51.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG30324-PA 164 CG30324-PA 1..164 1..164 895 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20289-PA 165 GI20289-PA 2..165 1..164 482 53 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11353-PA 164 GL11353-PA 1..164 1..164 556 60.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15762-PA 164 GA15762-PA 1..164 1..164 562 61 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20068-PA 164 GM20068-PA 1..164 1..164 847 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25549-PA 164 GD25549-PA 1..164 1..164 846 96.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22017-PA 164 GJ22017-PA 1..164 1..164 503 54.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19317-PA 165 GK19317-PA 1..165 1..164 483 54.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14075-PA 164 GE14075-PA 1..164 1..164 819 92.7 Plus