Clone IP08374 Report

Search the DGRC for IP08374

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:83
Well:74
Vector:pOT2
Associated Gene/TranscriptCG30432-RB
Protein status:IP08374.pep: gold
Preliminary Size:744
Sequenced Size:897

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30432 2005-01-01 Successful iPCR screen
CG30432 2008-04-29 Release 5.5 accounting
CG30432 2008-08-15 Release 5.9 accounting
CG30432 2008-12-18 5.12 accounting

Clone Sequence Records

IP08374.complete Sequence

897 bp (897 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022922

> IP08374.complete
AAACCTGTCAAATCAGTGAACAAATCTTTTTCTCTAGTATCGCCGGCATG
GAAGGCCGCAAAGAATTTCTGAATATTTTGTTGGTCATACAAATCATCTA
CATTGTGCCGGTTGGGATTATATGTTTGGTGATCGTGGCGTTTCAGGTGA
CGGGCTATCGTCTCAATGACTTTGTACTTTTCTCCTATATGAACTACATA
GAGCAACAAGCCCGTTCGTACACTCCGGAATCTTGGGATAAAGGACTCAA
CATAATAGTGTGGATCCACGTCGTCATCCTATACGTGGTATTTCGAAAGA
GGGAGTGTTTGAGGGTGCAGACTCTAGAGGACACTCGGCGCCAGTTTGAG
ATCGAAGATCTTTTTCGGATGGAGACTGAGTTCATGGAGCAGCTACGATC
CCAAGGCATCGAACTGGAGGATTCCACATTGGATTCGAGCTGCGTATAAG
CGTCTTGGCGGCGCATTCAGGAGCCAATCAAATATCTCGTTAATGCCGCC
GCCTTGGACAATGTTAATGCTGTATTCATCGTATGAGCGTATATATAGAT
CGCTCGCTTGATTGCCCAGAATTGAATTCAACATTTGTCCGCCGTGCGCT
ACACCTACACTGCTCAATTACCAGGCCGATCCAATATAATCCTCCTCGCC
CGAGTTGAACGTGCTCGGCTGGCATTACTACACACAGCTTTTATACTATA
TGTACACATATGTATTATCGCACTGTGAGATAGTTCATTGTTTGGTTCTG
CGCATGAGTATATTTTTATCGCGCACTGTGCCCCTTTCTTTCCACCACTT
GTGTGCACTTTTTACTGTTTGAAATAAATTGTAAATGATTTTTATTAAAA
TTTCCGCTTAAATTTTCAGCGGTAATACTGAAAAAAAAAAAAAAAAA

IP08374.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG30432-RA 956 CG30432-RA 77..956 1..880 4400 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2084466..2085345 880..1 4385 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6197387..6198266 880..1 4400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6198586..6199465 880..1 4400 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:50:05 has no hits.

IP08374.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:50:45 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2084466..2085345 1..880 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:30 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
CG30432-RA 77..525 1..449 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:18:48 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
CG30432-RA 77..525 1..449 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:00:18 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
CG30432-RB 1..402 48..449 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:03:01 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
CG30432-RA 77..525 1..449 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:04:34 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
CG30432-RB 1..402 48..449 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:18:51 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
CG30432-RA 77..744 1..668 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:18:48 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
CG30432-RA 77..956 1..880 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:00:18 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
CG30432-RB 1..880 1..880 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:03:01 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
CG30432-RA 77..744 1..668 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:04:34 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
CG30432-RB 1..880 1..880 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:45 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6197387..6198266 1..880 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:45 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6197387..6198266 1..880 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:45 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6197387..6198266 1..880 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:00:18 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2084892..2085771 1..880 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:00 Download gff for IP08374.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6198586..6199465 1..880 100   Minus

IP08374.pep Sequence

Translation from 2 to 448

> IP08374.pep
TCQISEQIFFSSIAGMEGRKEFLNILLVIQIIYIVPVGIICLVIVAFQVT
GYRLNDFVLFSYMNYIEQQARSYTPESWDKGLNIIVWIHVVILYVVFRKR
ECLRVQTLEDTRRQFEIEDLFRMETEFMEQLRSQGIELEDSTLDSSCV*

IP08374.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10827-PA 133 GG10827-PA 1..131 16..146 497 71.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG30432-PB 133 CG30432-PB 1..133 16..148 679 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16476-PA 64 GM16476-PA 1..64 85..148 277 85.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10330-PA 132 GD10330-PA 1..132 16..148 536 77.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19422-PA 135 GE19422-PA 1..135 16..148 526 73.3 Plus

IP08374.hyp Sequence

Translation from 2 to 448

> IP08374.hyp
TCQISEQIFFSSIAGMEGRKEFLNILLVIQIIYIVPVGIICLVIVAFQVT
GYRLNDFVLFSYMNYIEQQARSYTPESWDKGLNIIVWIHVVILYVVFRKR
ECLRVQTLEDTRRQFEIEDLFRMETEFMEQLRSQGIELEDSTLDSSCV*

IP08374.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG30432-PB 133 CG30432-PB 1..133 16..148 679 100 Plus