Clone IP08379 Report

Search the DGRC for IP08379

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:83
Well:79
Vector:pOT2
Associated Gene/TranscriptCG31206-RA
Protein status:IP08379.pep: gold
Preliminary Size:691
Sequenced Size:849

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31206 2005-01-01 Successful iPCR screen
CG31206 2008-04-29 Release 5.5 accounting
CG31206 2008-08-15 Release 5.9 accounting
CG31206 2008-12-18 5.12 accounting

Clone Sequence Records

IP08379.complete Sequence

849 bp (849 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022926

> IP08379.complete
CAACAAGCCAAATCCACTCCAAAATTCTGTTTTTATACTATCAAAATTAT
AATCTTTTAAATTATTTCATAAATTAGAACATGGAATACAGCGGAGTGCG
GTTACCCGGAATTTTTTGTCCGGATGAAAGCATTGAGCAGTTTGCAAGAC
TTTACGGAAGTGATAATTTTAGCAAAATGATGATAATAGCCACGACCAGT
AGTCCTCCGAGGACTATGCAGGCCACAACTCATTCACCTCCAGGAATGAT
GGGGGGGAATCCGTCCAGGTTTCAAGGGAATGCATCAACAGCTCACGATC
GAAATCTAAAAGTTAATCACCGATATGCTCATAATGTGCAGGCCCCATCC
AATCCGCACCCGGTCATAATGGGTCCGTCCAGGTTTCATGGAAATCTACC
ACCTATTCAGGATACATATTTAAAAAGTAGTCCCCGAGATCAAGGATTTC
ATGCTTATGGGGCCGTGCATAGAGGCTGTGGTGACCACTATAGTTATTCG
GCAAATTTGCAGAACTCTAAACCTGAATATCCTACAAGGCCCGACCAATC
GGGCACACAAAATCCGGGACAAATGTACTGCAATACTCAGCACTATCAGA
ATCTGAATTTTTATCATCCACCTCCACCTGGACCCAGATTTCCCTGGCTT
TAGAGCACATTTTCCGGCCAAATCCATTTAACAATAATCAACTCGCTAGT
TTGTAAGTTTTGTTGTTAAAAGTTTATCCATGGCGTGTATTTCTATAGCG
AAATTATTGTTTGGTATCGCAATTTAGTGGTGACTGTCTAAATTATATAT
ATAACCTAAAATAATGAATGAATGCCATAATGAAAAAAAAAAAAAAAAA

IP08379.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG31206-RA 1123 CG31206-RA 150..984 1..835 4175 100 Plus
CG31206.a 917 CG31206.a 394..897 332..835 2520 100 Plus
CG31206.a 917 CG31206.a 39..370 1..332 1660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15930921..15931317 832..436 1985 100 Minus
chr3R 27901430 chr3R 15931558..15931763 331..126 1030 100 Minus
chr3R 27901430 chr3R 15931819..15931948 130..1 635 99.2 Minus
chr3R 27901430 chr3R 15931381..15931485 436..332 510 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20106933..20107332 835..436 2000 100 Minus
3R 32079331 3R 20107573..20107778 331..126 1030 100 Minus
3R 32079331 3R 20107834..20107963 130..1 635 99.2 Minus
3R 32079331 3R 20107396..20107500 436..332 525 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19847764..19848163 835..436 2000 100 Minus
3R 31820162 3R 19848404..19848609 331..126 1030 100 Minus
3R 31820162 3R 19848665..19848794 130..1 635 99.2 Minus
3R 31820162 3R 19848227..19848331 436..332 525 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:50:46 has no hits.

IP08379.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:51:59 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15930921..15931316 437..832 100 <- Minus
chr3R 15931381..15931485 332..436 99 <- Minus
chr3R 15931558..15931763 126..331 100 <- Minus
chr3R 15931824..15931948 1..125 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:30 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31206-RA 1..573 81..653 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:44 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31206-RA 1..573 81..653 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:00:24 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31206-RA 1..573 81..653 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:12 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31206-RA 1..573 81..653 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:04:41 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31206-RA 1..573 81..653 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:10:13 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31206-RA 39..691 1..653 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:44 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31206-RA 39..870 1..832 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:00:24 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31206-RA 1..832 1..832 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:12 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31206-RA 39..691 1..653 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:04:41 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31206-RA 1..832 1..832 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:51:59 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20106936..20107331 437..832 100 <- Minus
3R 20107396..20107500 332..436 100 <- Minus
3R 20107573..20107778 126..331 100 <- Minus
3R 20107839..20107963 1..125 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:51:59 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20106936..20107331 437..832 100 <- Minus
3R 20107396..20107500 332..436 100 <- Minus
3R 20107573..20107778 126..331 100 <- Minus
3R 20107839..20107963 1..125 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:51:59 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20106936..20107331 437..832 100 <- Minus
3R 20107396..20107500 332..436 100 <- Minus
3R 20107573..20107778 126..331 100 <- Minus
3R 20107839..20107963 1..125 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:00:24 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15932658..15933053 437..832 100 <- Minus
arm_3R 15933118..15933222 332..436 100 <- Minus
arm_3R 15933295..15933500 126..331 100 <- Minus
arm_3R 15933561..15933685 1..125 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:42 Download gff for IP08379.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19847767..19848162 437..832 100 <- Minus
3R 19848227..19848331 332..436 100 <- Minus
3R 19848404..19848609 126..331 100 <- Minus
3R 19848670..19848794 1..125 100   Minus

IP08379.pep Sequence

Translation from 80 to 652

> IP08379.pep
MEYSGVRLPGIFCPDESIEQFARLYGSDNFSKMMIIATTSSPPRTMQATT
HSPPGMMGGNPSRFQGNASTAHDRNLKVNHRYAHNVQAPSNPHPVIMGPS
RFHGNLPPIQDTYLKSSPRDQGFHAYGAVHRGCGDHYSYSANLQNSKPEY
PTRPDQSGTQNPGQMYCNTQHYQNLNFYHPPPPGPRFPWL*

IP08379.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17334-PA 137 GF17334-PA 1..137 1..190 171 32.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15597-PA 195 GG15597-PA 1..195 1..190 664 76.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG31206-PA 190 CG31206-PA 1..190 1..190 1070 100 Plus
CG31206-PB 198 CG31206-PB 1..198 1..190 1051 96 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23209-PA 189 GM23209-PA 1..189 1..190 844 90.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:00:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20078-PA 189 GD20078-PA 1..189 1..190 851 91.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25086-PA 186 GE25086-PA 1..186 1..190 619 71.9 Plus

IP08379.hyp Sequence

Translation from 80 to 652

> IP08379.hyp
MEYSGVRLPGIFCPDESIEQFARLYGSDNFSKMMIIATTSSPPRTMQATT
HSPPGMMGGNPSRFQGNASTAHDRNLKVNHRYAHNVQAPSNPHPVIMGPS
RFHGNLPPIQDTYLKSSPRDQGFHAYGAVHRGCGDHYSYSANLQNSKPEY
PTRPDQSGTQNPGQMYCNTQHYQNLNFYHPPPPGPRFPWL*

IP08379.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG31206-PA 190 CG31206-PA 1..190 1..190 1070 100 Plus
CG31206-PB 198 CG31206-PB 1..198 1..190 1051 96 Plus