Clone IP08381 Report

Search the DGRC for IP08381

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:83
Well:81
Vector:pOT2
Associated Gene/TranscriptCG31269-RB
Protein status:IP08381.pep: gold
Preliminary Size:762
Sequenced Size:955

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31269 2005-01-01 Successful iPCR screen
CG31269 2008-04-29 Release 5.5 accounting
CG31269 2008-04-29 Picked prior to 5.5
CG31269 2008-08-15 Release 5.9 accounting
CG31269 2008-12-18 5.12 accounting

Clone Sequence Records

IP08381.complete Sequence

955 bp (955 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022930

> IP08381.complete
ACAAGATGTCGGCAGTGGTTTTACTTATTTTGTTGGGTCTTTCGGGACTC
GTATCCATAACAGCCATACGAATCAAGGGAAACTCAACGGATGGTCGGTT
TTACAAGGATCAACGGATCATCGGTGGTCAGGCAGCTGAGGATGGCTTCG
CTCCCTATCAGATATCCTTGCAGGGAATCTCCGGTGCCCACTCCTGTGGT
GGTGCCATAATAAACGAGACCTTCGTCCTGACAGCCGCTCACTGTGTCGA
AAATGCCTTTATTCCATGGCTGGTTGTCGTCACGGGCACTAATAAGTATA
ACCAACCAGGAGGCAGGTATTTCCTAAAAGCCATTCATATCCATTGTAAC
TACGATAATCCGGAGATGCACAATGATATTGCCCTGTTGGAATTAGTTGA
GCCAATTGCTTGGGACGAGCGCACTCAGCCGATCCCGTTGCCCTTGGTGC
CCATGCAGCCGGGTGATGAAGTAATCCTCACTGGTTGGGGATCCACGGTC
CTCTGGGGCACCAGTCCCATCGATTTGCAGGTTCTATACCTTCAGTACGT
TCCCCATCGCGAGTGCAAAGCCCTGCTGAGCAACGATGAAGATTGTGATG
TGGGTCACATTTGCACTTTTTCGCGGCTGGGAGAAGGTGCCTGCCATGGA
GATTCCGGTGGACCTCTGGTCAGCAATGGTTACCTGGTGGGACTGGTCAA
CTGGGGATGGCCCTGCGCAACAGGAGTTCCGGACGTTCATGCCAGTGTTT
ATTTCTATCGTGATTGGATACGCAATGTCATGAGTGGGAATTCAAAGTGC
ACTGGGTTCAGCTCCAACCAATCCTAAAGGTTCCGTTTACTGTGACTATC
ATAGTGCACCATAAAAAATACTAATTTATAAGGCAACGATAAAATTGCCT
CGATAAGCAGGGGCCAGTTAATAAAGTTTTGATAGCGAAAAAAAAAAAAA
AAAAA

IP08381.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG31269-RB 952 CG31269-RB 16..952 1..937 4685 100 Plus
CG31265-RA 897 CG31265-RA 613..731 599..717 235 79.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12951551..12952282 1..732 3660 100 Plus
chr3R 27901430 chr3R 12952415..12952625 727..937 1040 99.5 Plus
chr3R 27901430 chr3R 12953260..12953378 599..717 220 79 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17127126..17127857 1..732 3660 100 Plus
3R 32079331 3R 17127991..17128203 727..939 1050 99.5 Plus
3R 32079331 3R 17128836..17128954 599..717 235 79.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16867957..16868688 1..732 3660 100 Plus
3R 31820162 3R 16868822..16869034 727..939 1050 99.5 Plus
3R 31820162 3R 16869667..16869785 599..717 235 79.8 Plus
Blast to na_te.dros performed on 2019-03-16 03:33:18 has no hits.

IP08381.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:34:12 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12951551..12952281 1..731 100 -> Plus
chr3R 12952420..12952625 732..937 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:32 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
CG31269-RB 1..822 6..827 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:18:49 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
CG31269-RB 1..822 6..827 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:59:38 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
CG31269-RB 1..822 6..827 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:03:02 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
CG31269-RB 1..822 6..827 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:08:35 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
CG31269-RB 1..822 6..827 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:18:53 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
CG31269-RB 1..937 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:18:49 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
CG31269-RB 1..937 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:59:38 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
CG31269-RB 1..937 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:03:02 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
CG31269-RB 1..937 1..937 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:08:35 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
CG31269-RB 1..937 1..937 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:12 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17127126..17127856 1..731 100 -> Plus
3R 17127996..17128201 732..937 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:12 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17127126..17127856 1..731 100 -> Plus
3R 17127996..17128201 732..937 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:12 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17127126..17127856 1..731 100 -> Plus
3R 17127996..17128201 732..937 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:59:38 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12952848..12953578 1..731 100 -> Plus
arm_3R 12953718..12953923 732..937 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:01 Download gff for IP08381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16867957..16868687 1..731 100 -> Plus
3R 16868827..16869032 732..937 100   Plus

IP08381.hyp Sequence

Translation from 2 to 826

> IP08381.hyp
KMSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFA
PYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN
QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP
MQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDV
GHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVY
FYRDWIRNVMSGNSKCTGFSSNQS*

IP08381.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG31269-PB 273 CG31269-PB 1..273 2..274 1482 100 Plus
CG31265-PA 266 CG31265-PA 2..264 1..266 766 56.9 Plus
CG17475-PB 288 CG17475-PB 9..284 6..272 673 48.2 Plus
CG17475-PA 288 CG17475-PA 9..284 6..272 673 48.2 Plus
CG5255-PA 273 CG5255-PA 1..254 6..261 607 50 Plus

IP08381.pep Sequence

Translation from 2 to 826

> IP08381.pep
KMSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFA
PYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN
QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP
MQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDV
GHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVY
FYRDWIRNVMSGNSKCTGFSSNQS*

IP08381.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17129-PA 274 GF17129-PA 5..272 7..273 1120 78.7 Plus
Dana\GF19903-PA 267 GF19903-PA 37..265 38..266 702 55.9 Plus
Dana\GF17862-PA 288 GF17862-PA 50..285 38..272 658 54.7 Plus
Dana\GF17863-PA 269 GF17863-PA 25..259 35..266 624 49.8 Plus
Dana\GF17133-PA 278 GF17133-PA 25..264 34..272 592 49.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22017-PA 273 GG22017-PA 18..273 19..274 1295 92.6 Plus
Dere\GG22028-PA 266 GG22028-PA 36..264 38..266 752 60.9 Plus
Dere\GG16790-PA 288 GG16790-PA 9..284 6..272 639 46.9 Plus
Dere\GG22071-PA 273 GG22071-PA 25..254 34..261 606 51.3 Plus
Dere\GG16791-PA 267 GG16791-PA 24..258 36..267 581 47.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14062-PA 266 GH14062-PA 8..265 5..267 728 51.3 Plus
Dgri\GH14252-PA 282 GH14252-PA 6..280 5..272 664 48.6 Plus
Dgri\GH14066-PA 271 GH14066-PA 2..269 1..265 622 45.7 Plus
Dgri\GH14067-PA 282 GH14067-PA 24..253 34..261 606 51.3 Plus
Dgri\GH14253-PA 260 GH14253-PA 22..252 39..266 589 48.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG31269-PB 273 CG31269-PB 1..273 2..274 1482 100 Plus
CG31265-PA 266 CG31265-PA 2..264 1..266 766 56.9 Plus
CG17475-PB 288 CG17475-PB 9..284 6..272 673 48.2 Plus
CG17475-PA 288 CG17475-PA 9..284 6..272 673 48.2 Plus
CG5255-PA 273 CG5255-PA 1..254 6..261 607 50 Plus
CG5246-PA 272 CG5246-PA 1..266 2..261 594 44.9 Plus
CG17477-PA 267 CG17477-PA 27..257 39..266 590 48.1 Plus
CG4053-PB 265 CG4053-PB 6..259 4..262 558 44.6 Plus
CG31266-PB 282 CG31266-PB 7..278 7..262 484 40.4 Plus
CG31267-PA 275 CG31267-PA 9..271 4..262 463 39.2 Plus
thetaTry-PA 262 CG12385-PA 5..257 5..258 349 34.1 Plus
Ser6-PA 259 CG2071-PA 31..254 38..257 343 33.9 Plus
CG1304-PA 260 CG1304-PA 1..255 2..258 339 33.3 Plus
CG17571-PB 258 CG17571-PB 5..251 13..256 338 32.8 Plus
CG17571-PA 258 CG17571-PA 5..251 13..256 338 32.8 Plus
CG30025-PA 253 CG30025-PA 7..251 16..258 323 33.2 Plus
gammaTry-PA 253 CG30028-PA 7..249 16..256 320 33.1 Plus
deltaTry-PA 253 CG12351-PA 7..249 16..256 320 33.1 Plus
CG30031-PA 253 CG30031-PA 7..249 16..256 320 33.1 Plus
CG31954-PA 277 CG31954-PA 48..272 36..257 320 36.1 Plus
CG12256-PA 283 CG12256-PA 1..282 2..260 320 33.9 Plus
iotaTry-PA 252 CG7754-PA 7..245 2..256 316 34.5 Plus
alphaTry-PA 256 CG18444-PA 7..255 16..264 314 32.9 Plus
betaTry-PB 253 CG18211-PB 7..251 16..258 313 33.6 Plus
betaTry-PA 253 CG18211-PA 7..251 16..258 313 33.6 Plus
Try29F-PD 267 CG9564-PD 10..264 2..259 309 32.8 Plus
Try29F-PC 267 CG9564-PC 10..264 2..259 309 32.8 Plus
epsilonTry-PA 256 CG18681-PA 1..249 10..256 303 30.7 Plus
CG16749-PA 265 CG16749-PA 29..258 38..257 301 37.5 Plus
Send1-PA 255 CG17012-PA 28..239 37..256 300 35 Plus
Ser8-PA 260 CG4812-PA 34..253 38..256 296 33 Plus
Send2-PA 239 CG18125-PA 7..236 8..263 295 35.1 Plus
CG13430-PB 267 CG13430-PB 22..259 27..256 290 32.8 Plus
CG13430-PA 267 CG13430-PA 22..259 27..256 290 32.8 Plus
CG12951-PA 265 CG12951-PA 29..259 38..258 289 34.1 Plus
CG11192-PB 279 CG11192-PB 25..259 36..256 289 37.3 Plus
CG3916-PA 267 CG3916-PA 30..262 38..261 288 36.4 Plus
CG32270-PA 259 CG32270-PA 27..251 35..256 286 32.6 Plus
CG11912-PA 271 CG11912-PA 12..264 16..256 285 33.7 Plus
CG8299-PA 260 CG8299-PA 28..252 39..256 283 33.6 Plus
sphe-PA 249 CG9675-PA 6..245 8..257 279 31.8 Plus
zetaTry-PA 280 CG12387-PA 3..279 3..262 279 34.3 Plus
CG17234-PA 251 CG17234-PA 24..248 36..261 274 34.3 Plus
etaTry-PA 262 CG12386-PA 1..254 2..256 273 31.8 Plus
CG7829-PA 253 CG7829-PA 9..250 8..261 272 29.7 Plus
CG32808-PA 284 CG32808-PA 26..263 35..264 270 34 Plus
CG30371-PA 399 CG30371-PA 127..395 15..266 266 30.3 Plus
CG31681-PA 264 CG31681-PA 5..256 5..263 264 30.6 Plus
lambdaTry-PA 272 CG12350-PA 33..256 36..256 264 34.6 Plus
Ser12-PA 245 CG17240-PA 22..242 37..260 263 32.3 Plus
CG11911-PA 277 CG11911-PA 37..275 39..265 263 31.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24438-PA 269 GI24438-PA 2..268 1..267 761 53.2 Plus
Dmoj\GI23144-PA 284 GI23144-PA 36..281 32..272 598 49.2 Plus
Dmoj\GI24442-PA 279 GI24442-PA 12..256 19..261 590 47.8 Plus
Dmoj\GI23145-PA 265 GI23145-PA 26..262 39..272 569 47.3 Plus
Dmoj\GI24441-PA 272 GI24441-PA 40..264 36..259 561 48.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27271-PA 271 GL27271-PA 1..270 2..273 1080 71.3 Plus
Dper\GL27272-PA 264 GL27272-PA 8..263 7..267 751 56.1 Plus
Dper\GL27214-PA 286 GL27214-PA 9..282 3..272 643 47.4 Plus
Dper\GL27215-PA 268 GL27215-PA 24..266 35..273 610 49 Plus
Dper\GL27275-PA 273 GL27275-PA 35..267 31..261 588 48.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16138-PA 271 GA16138-PA 1..270 2..273 1073 71 Plus
Dpse\GA14522-PA 286 GA14522-PA 9..282 3..272 643 47.4 Plus
Dpse\GA16134-PA 290 GA16134-PA 8..237 7..241 636 54.2 Plus
Dpse\GA18766-PA 280 GA18766-PA 27..256 34..261 610 51.3 Plus
Dpse\GA14523-PA 268 GA14523-PA 24..266 35..273 609 48.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15209-PA 239 GM15209-PA 1..239 2..274 1076 81.7 Plus
Dsec\GM15210-PA 266 GM15210-PA 36..264 38..266 731 60.4 Plus
Dsec\GM15383-PA 289 GM15383-PA 10..285 6..272 639 47.8 Plus
Dsec\GM15215-PA 273 GM15215-PA 25..254 34..261 614 52.6 Plus
Dsec\GM15384-PA 267 GM15384-PA 27..258 39..267 577 47.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19140-PA 274 GD19140-PA 1..274 2..274 1399 96.4 Plus
Dsim\GD19141-PA 266 GD19141-PA 36..264 38..266 742 61.7 Plus
Dsim\GD20249-PA 288 GD20249-PA 9..284 6..272 656 48.2 Plus
Dsim\GD19145-PA 273 GD19145-PA 25..254 34..261 612 52.2 Plus
Dsim\GD20250-PA 267 GD20250-PA 27..258 39..267 582 48.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10713-PA 268 GJ10713-PA 31..267 31..267 713 56.1 Plus
Dvir\GJ10446-PA 290 GJ10446-PA 30..287 16..272 627 48.6 Plus
Dvir\GJ10717-PA 272 GJ10717-PA 40..270 36..265 603 50.4 Plus
Dvir\GJ10447-PA 268 GJ10447-PA 29..265 39..272 594 48.1 Plus
Dvir\GJ10718-PA 280 GJ10718-PA 28..257 34..261 594 51.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12195-PA 272 GK12195-PA 21..271 22..273 1018 73.8 Plus
Dwil\GK12196-PA 282 GK12196-PA 32..260 37..265 746 61.7 Plus
Dwil\GK10884-PA 290 GK10884-PA 49..286 38..272 672 55 Plus
Dwil\GK10885-PA 274 GK10885-PA 1..266 7..267 642 48.5 Plus
Dwil\GK12201-PA 260 GK12201-PA 11..240 34..261 590 50.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24613-PA 274 GE24613-PA 1..274 2..274 1362 93.1 Plus
Dyak\GE24614-PA 266 GE24614-PA 36..264 38..266 747 61.3 Plus
Dyak\GE26105-PA 296 GE26105-PA 9..284 6..272 652 48.7 Plus
Dyak\GE10113-PA 277 GE10113-PA 25..254 34..261 607 52.2 Plus
Dyak\GE26106-PA 267 GE26106-PA 24..263 36..272 577 47.1 Plus