Clone IP08408 Report

Search the DGRC for IP08408

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:84
Well:8
Vector:pOT2
Associated Gene/TranscriptCG32196-RB
Protein status:IP08408.pep: gold
Preliminary Size:645
Sequenced Size:843

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32196 2005-01-01 Successful iPCR screen
CG32196 2008-04-29 Release 5.5 accounting
CG32196 2008-08-15 Release 5.9 accounting
CG32196 2008-12-18 5.12 accounting

Clone Sequence Records

IP08408.complete Sequence

843 bp (843 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022946

> IP08408.complete
ATCGATAGGAAACTTGCCGAGCAGTGTAGCTCTACAAAAAGATGTTATCA
TTTTGTCAATGACATTTCCCTACAATCTGTGCGTGTGTCTTAAAAGTGTA
CACAAGTTTCTGTTTAATTTGAAGTGTTGACGTGTTTTATTTTCATGAAT
TTAAAACTTCACCATTTTACTACTATGGCCACTACTTTCTTTTATTTCGG
TTTCGGTAGCAATATGCTAGCCAGTCGGATTCATATACAAAATCCAACTG
CAAAGAGGATTGGTGTCGGTAAATTAGAGAACTTTCGGTTAGACTTTCAC
ACTGGATCGAAAAATTGGCTAGGCGCTCCCGCTACAATTGTACCCACTCA
AGGATCACATGTGTACGGAGCCATTTGGGAGATTGATATGTGCAACCTAA
AGGATTTGGATGATCAGGAGAGTGTGCCCGCTGGCGTATATGTTCCGATT
AGTGTTCCCGTTCACCTGTTGAACACTGATTCAAGCATTACCTGTCGTGC
ATATCACTTGACAAATCAGCCTCAAACAGACCTCCATGCTGGAGGTGGCC
AGGAAATTATTCCACACGATCGACAGCCTTCGCAAACGTACCTTAAAGTT
TTGGTGAAAGGAGCTACGGAATCCGGAGTCCCGGATGAATACATCGAATG
GCTGAGAGGGATCAAGCACAATGGCAAACAAGTGCCAGCCATGGAGGCAA
AACTTGAATTGGATAAAGTGCAACTTAGTTGATCAGAAGAGCTTTCGTTT
TCCTGGCGGTAAAATGTATTAAAATGAAAACCTCTCATTAAATATTTATG
ATTTATAATATGAATTATTTTAAACTAAAAAAAAAAAAAAAAA

IP08408.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32196-RB 849 CG32196-RB 11..837 1..827 4135 100 Plus
CG32196.a 715 CG32196.a 157..704 280..827 2740 100 Plus
CG32196.a 715 CG32196.a 1..156 1..156 780 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18449059..18449471 826..414 2035 99.5 Minus
chr3L 24539361 chr3L 18449530..18449665 413..278 680 100 Minus
chr3L 24539361 chr3L 18450463..18450622 156..1 645 95 Minus
chr3L 24539361 chr3L 18449818..18449940 279..157 615 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18459463..18459876 827..414 2070 100 Minus
3L 28110227 3L 18460869..18461024 156..1 780 100 Minus
3L 28110227 3L 18459936..18460071 413..278 680 100 Minus
3L 28110227 3L 18460224..18460346 279..157 615 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18452563..18452976 827..414 2070 100 Minus
3L 28103327 3L 18453969..18454124 156..1 780 100 Minus
3L 28103327 3L 18453036..18453171 413..278 680 100 Minus
3L 28103327 3L 18453324..18453446 279..157 615 100 Minus
Blast to na_te.dros performed 2019-03-15 21:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 5050..5128 823..744 127 63.7 Minus
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 181..261 823..743 117 60.5 Minus

IP08408.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:52:31 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18449818..18449940 157..279 100 <- Minus
chr3L 18450463..18450622 1..156 95   Minus
chr3L 18449100..18449471 414..785 99 <- Minus
chr3L 18449530..18449663 280..413 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:36 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32196-RB 1..588 145..732 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:18:35 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32196-RB 1..588 145..732 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:01:33 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32196-RB 1..588 145..732 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:51 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32196-RB 1..588 145..732 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:05:42 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32196-RB 1..588 145..732 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:18:32 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32196-RB 1..821 1..821 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:18:34 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32196-RB 1..821 1..821 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:01:33 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32196-RB 1..826 1..826 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:51 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32196-RB 1..824 1..824 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:05:42 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32196-RB 1..826 1..826 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:31 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18459464..18459876 414..826 100 <- Minus
3L 18459936..18460069 280..413 100 <- Minus
3L 18460224..18460346 157..279 100 <- Minus
3L 18460869..18461024 1..156 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:31 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18459464..18459876 414..826 100 <- Minus
3L 18459936..18460069 280..413 100 <- Minus
3L 18460224..18460346 157..279 100 <- Minus
3L 18460869..18461024 1..156 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:31 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18459464..18459876 414..826 100 <- Minus
3L 18459936..18460069 280..413 100 <- Minus
3L 18460224..18460346 157..279 100 <- Minus
3L 18460869..18461024 1..156 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:01:33 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18453969..18454124 1..156 100   Minus
arm_3L 18452564..18452976 414..826 100 <- Minus
arm_3L 18453036..18453169 280..413 100 <- Minus
arm_3L 18453324..18453446 157..279 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:38:45 Download gff for IP08408.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18453969..18454124 1..156 100   Minus
3L 18452564..18452976 414..826 100 <- Minus
3L 18453036..18453169 280..413 100 <- Minus
3L 18453324..18453446 157..279 100 <- Minus

IP08408.pep Sequence

Translation from 144 to 731

> IP08408.pep
MNLKLHHFTTMATTFFYFGFGSNMLASRIHIQNPTAKRIGVGKLENFRLD
FHTGSKNWLGAPATIVPTQGSHVYGAIWEIDMCNLKDLDDQESVPAGVYV
PISVPVHLLNTDSSITCRAYHLTNQPQTDLHAGGGQEIIPHDRQPSQTYL
KVLVKGATESGVPDEYIEWLRGIKHNGKQVPAMEAKLELDKVQLS*

IP08408.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10819-PA 172 GF10819-PA 1..172 24..195 726 76.7 Plus
Dana\GF10818-PA 229 GF10818-PA 51..229 15..194 504 54.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15743-PA 208 GG15743-PA 1..163 24..191 801 89.3 Plus
Dere\GG15742-PA 220 GG15742-PA 42..220 15..194 500 55 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17112-PA 186 GH17112-PA 1..186 11..195 709 69.4 Plus
Dgri\GH23201-PA 186 GH23201-PA 1..186 11..195 709 68.8 Plus
Dgri\GH17111-PA 220 GH17111-PA 39..218 15..194 518 53 Plus
Dgri\GH23200-PA 220 GH23200-PA 39..218 15..194 515 53 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG32196-PB 195 CG32196-PB 1..195 1..195 1041 100 Plus
CG32196-PC 154 CG32196-PC 3..154 44..195 809 99.3 Plus
CG4306-PA 220 CG4306-PA 42..220 15..194 479 54.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11715-PA 190 GI11715-PA 1..190 11..195 696 68.4 Plus
Dmoj\GI11714-PA 213 GI11714-PA 34..213 15..194 510 53 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22704-PA 173 GL22704-PA 1..173 24..195 718 75.6 Plus
Dper\GL22703-PA 196 GL22703-PA 49..195 12..194 315 40.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16751-PA 173 GA16751-PA 1..173 24..195 718 75.6 Plus
Dpse\GA18096-PA 237 GA18096-PA 53..236 12..194 502 52.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14941-PA 172 GM14941-PA 1..172 24..195 870 93.6 Plus
Dsec\GM14939-PA 169 GM14939-PA 10..169 34..194 345 46.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12344-PA 172 GD12344-PA 1..172 24..195 872 93.6 Plus
Dsim\GD12343-PA 218 GD12343-PA 26..218 1..194 503 51.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11391-PA 172 GJ11391-PA 1..172 24..195 644 68.8 Plus
Dvir\GJ11390-PA 217 GJ11390-PA 36..217 15..194 508 55.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11538-PA 192 GK11538-PA 1..192 11..195 766 76.6 Plus
Dwil\GK11527-PA 227 GK11527-PA 45..227 15..194 481 52.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22075-PA 196 GE22075-PA 1..166 24..194 816 89.5 Plus
Dyak\GE22074-PA 220 GE22074-PA 42..220 15..194 497 55 Plus

IP08408.hyp Sequence

Translation from 144 to 731

> IP08408.hyp
MNLKLHHFTTMATTFFYFGFGSNMLASRIHIQNPTAKRIGVGKLENFRLD
FHTGSKNWLGAPATIVPTQGSHVYGAIWEIDMCNLKDLDDQESVPAGVYV
PISVPVHLLNTDSSITCRAYHLTNQPQTDLHAGGGQEIIPHDRQPSQTYL
KVLVKGATESGVPDEYIEWLRGIKHNGKQVPAMEAKLELDKVQLS*

IP08408.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG32196-PB 195 CG32196-PB 1..195 1..195 1041 100 Plus
CG32196-PC 154 CG32196-PC 3..154 44..195 809 99.3 Plus
CG4306-PA 220 CG4306-PA 42..220 15..194 479 54.4 Plus