Clone IP08413 Report

Search the DGRC for IP08413

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:84
Well:13
Vector:pOT2
Associated Gene/TranscriptCG32313-RA
Protein status:IP08413.pep: gold
Preliminary Size:737
Sequenced Size:759

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32313 2005-01-01 Successful iPCR screen
CG32313 2008-04-29 Release 5.5 accounting
CG32313 2008-08-15 Release 5.9 accounting
CG32313 2008-12-18 5.12 accounting

Clone Sequence Records

IP08413.complete Sequence

759 bp (759 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022950

> IP08413.complete
ACTATGTGAAAATTGTCATATTCTGGAAAATCTTTCTGCGAAATAAGTAA
CAAGCAATGAGCATAAAAATTATTTTGTTTTTAATCGCCATCGAGTGCAA
CCAGACAATCGGCATAGGTCTTCGCTCCTTAATCCTGGAGGCTCACAATC
GAAGGAGGGCCAAGTACGGTAATCAGCCCATGGTTCTGGACGAAGAACTC
TGTACAGAGTGCTCAGAATACGCAGATGAAATAGTCAGGAATGAAGGTGT
ATATACAGAGAACTACTTGGAATACCTGTATGCAACGGACCCAATATCAG
CAAAGCACCTTCAAGTCGTCTGCGTTTTCCGGGAGGCCTTGCCTAGGGAA
TGTGTTCGAATTTGGTTTCATTACCGAGGCTTCGCCGAGAACACAAAGTA
TTACAGGTTTACGGCCATGATATGGAACGCCTCCACCAGACTTGGCGTTG
GACTAGGCAGAATACAGGAAACGCGATACCTAGTGGTGAGATATGCTCCT
CCTGGAAACATTTTGCGAGAGATGGCGTCCAATGTTCCCAAGCGACCGAC
AACGTTTTGGGATGCAGAACACATTGTTGACCATGGGTTTGAGTTCGCAT
AACATTTGCTCGCAATGGCGTCAACAATATATTTGGTAACTGGCTGTCTT
TCGTAACGACCTTATTAAATTTATATCTGTGCGGAACTTCCAGAATTTTG
TAGATTTTCCAGCGGTATTCGAACTAAATCGTATATATCAAAAAAAAAAA
AAAAAAAAA

IP08413.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32313-RA 870 CG32313-RA 131..870 1..740 3700 100 Plus
CG32313.a 736 CG32313.a 1..736 1..740 3615 99.4 Plus
CG7852-RA 5498 CG7852-RA 5414..5498 740..656 425 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1544312..1544594 739..464 1275 97.5 Minus
chr3L 24539361 chr3L 1544661..1544896 463..228 1180 100 Minus
chr3L 24539361 chr3L 1544958..1545092 228..94 675 100 Minus
chr3L 24539361 chr3L 1545141..1545235 95..1 475 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1544827..1545103 740..464 1385 100 Minus
3L 28110227 3L 1545170..1545405 463..228 1180 100 Minus
3L 28110227 3L 1545473..1545607 228..94 675 100 Minus
3L 28110227 3L 1545656..1545750 95..1 475 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1544827..1545103 740..464 1385 100 Minus
3L 28103327 3L 1545170..1545405 463..228 1180 100 Minus
3L 28103327 3L 1545473..1545607 228..94 675 100 Minus
3L 28103327 3L 1545656..1545750 95..1 475 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:49:50 has no hits.

IP08413.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:50:38 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1544312..1544594 464..739 97 <- Minus
chr3L 1544661..1544896 228..463 100 <- Minus
chr3L 1544959..1545090 96..227 100 <- Minus
chr3L 1545141..1545235 1..95 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:37 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG32313-RA 1..546 57..602 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:18:36 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG32313-RA 1..546 57..602 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:51:53 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG32313-RA 1..546 57..602 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:52 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG32313-RA 1..546 57..602 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:21:45 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG32313-RA 1..546 57..602 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:18:34 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG32313-RA 1..732 8..739 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:18:36 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG32313-RA 1..732 8..739 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:51:53 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG32313-RA 1..732 8..739 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:52 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG32313-RA 1..732 8..739 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:21:45 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG32313-RA 1..732 8..739 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:50:38 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1545474..1545605 96..227 100 <- Minus
3L 1545656..1545750 1..95 100   Minus
3L 1544828..1545103 464..739 100 <- Minus
3L 1545170..1545405 228..463 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:50:38 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1545474..1545605 96..227 100 <- Minus
3L 1545656..1545750 1..95 100   Minus
3L 1544828..1545103 464..739 100 <- Minus
3L 1545170..1545405 228..463 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:50:38 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1545474..1545605 96..227 100 <- Minus
3L 1545656..1545750 1..95 100   Minus
3L 1544828..1545103 464..739 100 <- Minus
3L 1545170..1545405 228..463 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:51:53 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1544828..1545103 464..739 100 <- Minus
arm_3L 1545170..1545405 228..463 100 <- Minus
arm_3L 1545474..1545605 96..227 100 <- Minus
arm_3L 1545656..1545750 1..95 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:38:47 Download gff for IP08413.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1545474..1545605 96..227 100 <- Minus
3L 1545656..1545750 1..95 100   Minus
3L 1544828..1545103 464..739 100 <- Minus
3L 1545170..1545405 228..463 100 <- Minus

IP08413.pep Sequence

Translation from 56 to 601

> IP08413.pep
MSIKIILFLIAIECNQTIGIGLRSLILEAHNRRRAKYGNQPMVLDEELCT
ECSEYADEIVRNEGVYTENYLEYLYATDPISAKHLQVVCVFREALPRECV
RIWFHYRGFAENTKYYRFTAMIWNASTRLGVGLGRIQETRYLVVRYAPPG
NILREMASNVPKRPTTFWDAEHIVDHGFEFA*

IP08413.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18369-PA 173 GF18369-PA 26..157 27..162 165 30.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14591-PA 217 GG14591-PA 1..179 1..179 778 75.4 Plus
Dere\GG13534-PA 197 GG13534-PA 1..157 1..160 165 29 Plus
Dere\GG13579-PA 196 GG13579-PA 6..159 3..160 164 30.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13090-PA 167 GH13090-PA 32..163 26..160 147 29 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG32313-PA 181 CG32313-PA 1..181 1..181 964 100 Plus
CG32313-PB 182 CG32313-PB 1..182 1..181 952 99.5 Plus
CG32313-PC 65 CG32313-PC 1..58 1..57 280 98.3 Plus
CG31286-PB 205 CG31286-PB 8..164 5..163 187 34.7 Plus
CG31482-PA 195 CG31482-PA 6..157 6..160 166 29.9 Plus
CG16995-PA 146 CG16995-PA 10..141 26..160 155 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14160-PA 145 GI14160-PA 10..141 26..160 167 30.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23728-PA 166 GL23728-PA 17..154 18..161 178 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25572-PA 201 GA25572-PA 2..160 3..167 195 31.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14205-PA 218 GM14205-PA 1..180 1..179 884 90.6 Plus
Dsec\GM10906-PA 205 GM10906-PA 6..162 3..161 196 34.7 Plus
Dsec\GM10902-PA 247 GM10902-PA 79..209 27..160 163 30.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13468-PA 218 GD13468-PA 1..180 1..179 891 91.7 Plus
Dsim\GD19885-PA 205 GD19885-PA 4..162 1..161 195 34.3 Plus
Dsim\GD19881-PA 184 GD19881-PA 11..146 22..160 164 30.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10085-PA 194 GJ10085-PA 61..191 26..162 163 29.9 Plus
Dvir\GJ17497-PA 146 GJ17497-PA 10..132 26..151 143 32.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11578-PA 150 GK11578-PA 7..147 21..162 182 32 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20951-PA 217 GE20951-PA 1..179 1..179 765 74.3 Plus
Dyak\GE10228-PA 193 GE10228-PA 6..156 6..160 183 31.1 Plus
Dyak\GE10233-PA 207 GE10233-PA 4..162 1..161 181 30.8 Plus
Dyak\GE10229-PA 193 GE10229-PA 1..156 1..160 178 29.3 Plus

IP08413.hyp Sequence

Translation from 56 to 601

> IP08413.hyp
MSIKIILFLIAIECNQTIGIGLRSLILEAHNRRRAKYGNQPMVLDEELCT
ECSEYADEIVRNEGVYTENYLEYLYATDPISAKHLQVVCVFREALPRECV
RIWFHYRGFAENTKYYRFTAMIWNASTRLGVGLGRIQETRYLVVRYAPPG
NILREMASNVPKRPTTFWDAEHIVDHGFEFA*

IP08413.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG32313-PA 181 CG32313-PA 1..181 1..181 964 100 Plus
CG32313-PB 182 CG32313-PB 1..182 1..181 952 99.5 Plus
CG32313-PC 65 CG32313-PC 1..58 1..57 280 98.3 Plus
CG31286-PB 205 CG31286-PB 8..164 5..163 187 34.7 Plus
CG31482-PA 195 CG31482-PA 6..157 6..160 166 29.9 Plus