Clone IP08420 Report

Search the DGRC for IP08420

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:84
Well:20
Vector:pOT2
Associated Gene/TranscriptCG32440-RA
Protein status:IP08420.pep: gold
Preliminary Size:633
Sequenced Size:546

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32440 2005-01-01 Successful iPCR screen
CG32440 2008-04-29 Release 5.5 accounting
CG32440 2008-08-15 Release 5.9 accounting
CG32440 2008-12-18 5.12 accounting

Clone Sequence Records

IP08420.complete Sequence

546 bp (546 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022966

> IP08420.complete
TTCGACGAGGAATTTGCCTTTTTTTCGTTTCAATCCCAAGATCAGTGGGA
TCCGACCGAATCATGTCATCGCAGTTTCGTGAGAAGCGCGGATTAGCTAG
CAGTGCCAATAATGAACTGCCCACCATGGATCCCAACGAGAGTGACTTCG
CTCTGGAGCTGAAGCCAGCACCCAAACAGACCTGCATTCCGACGCACCAA
CGCCAGAGATTGGCCAGCTCGGACACCAACGTCTATCAGCGTGAGAGCGT
GTTTGATATACCGGACAAGTCCTGGTCAGTCCTGTACTTTGGATCCGGCA
AGGACAGTTCCTCGAAATAGCTGTACTAGAAAGCTAGAAAGCTACTAGAA
CAACATTCCGTTCTGCGCCACTTTAAATCGAATGTCTGCCCACTGCCCAC
GCCTGGCCCACTGATTGACTCCTTCGTCACCACATCCATCCACCACGCCA
GTCATCCATCAGATGTCGCGAAATGTTATATACAATTAAAACTCACCCTC
GTGCCACTGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP08420.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG32440-RA 714 CG32440-RA 182..692 1..511 2555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21349957..21350237 230..510 1405 100 Plus
chr3L 24539361 chr3L 21349310..21349538 1..229 1145 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21360949..21361230 230..511 1410 100 Plus
3L 28110227 3L 21360302..21360530 1..229 1145 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21354049..21354330 230..511 1410 100 Plus
3L 28103327 3L 21353402..21353630 1..229 1145 100 Plus
Blast to na_te.dros performed 2019-03-16 09:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 2352..2482 186..309 115 58.8 Plus

IP08420.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:47:05 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21349310..21349538 1..229 100 -> Plus
chr3L 21349957..21350237 230..510 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:42 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 1..258 63..320 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:38:33 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 1..258 63..320 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:40 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 1..258 63..320 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:13:37 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 1..258 63..320 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:45:19 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 1..258 63..320 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:10:31 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 124..633 1..510 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:38:33 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 124..633 1..510 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:40 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 124..633 1..510 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:13:38 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 124..633 1..510 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:45:19 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 124..633 1..510 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:47:05 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21360302..21360530 1..229 100 -> Plus
3L 21360949..21361229 230..510 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:47:05 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21360302..21360530 1..229 100 -> Plus
3L 21360949..21361229 230..510 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:47:05 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21360302..21360530 1..229 100 -> Plus
3L 21360949..21361229 230..510 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:40 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21353402..21353630 1..229 100 -> Plus
arm_3L 21354049..21354329 230..510 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:28 Download gff for IP08420.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21354049..21354329 230..510 100   Plus
3L 21353402..21353630 1..229 100 -> Plus

IP08420.hyp Sequence

Translation from 2 to 319

> IP08420.hyp
RRGICLFFVSIPRSVGSDRIMSSQFREKRGLASSANNELPTMDPNESDFA
LELKPAPKQTCIPTHQRQRLASSDTNVYQRESVFDIPDKSWSVLYFGSGK
DSSSK*

IP08420.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32440-PA 85 CG32440-PA 1..85 21..105 441 100 Plus

IP08420.pep Sequence

Translation from 2 to 319

> IP08420.pep
RRGICLFFVSIPRSVGSDRIMSSQFREKRGLASSANNELPTMDPNESDFA
LELKPAPKQTCIPTHQRQRLASSDTNVYQRESVFDIPDKSWSVLYFGSGK
DSSSK*

IP08420.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10281-PA 88 GF10281-PA 1..88 21..105 257 60.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16181-PA 85 GG16181-PA 1..84 21..104 403 89.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16877-PA 91 GH16877-PA 32..87 46..101 164 55.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG32440-PA 85 CG32440-PA 1..85 21..105 441 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12020-PA 87 GI12020-PA 1..83 21..101 212 50.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21771-PA 79 GL21771-PA 4..79 28..105 171 49.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26396-PA 79 GA26396-PA 4..79 28..105 171 49.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22364-PA 85 GM22364-PA 1..85 21..105 415 91.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14956-PA 85 GD14956-PA 1..85 21..105 415 91.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13290-PA 87 GJ13290-PA 29..83 47..101 197 61.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20474-PA 81 GK20474-PA 17..81 41..105 220 61.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23264-PA 85 GE23264-PA 1..81 21..101 408 93.8 Plus
Dyak\GE19752-PA 85 GE19752-PA 1..81 21..101 408 93.8 Plus