Clone IP08424 Report

Search the DGRC for IP08424

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:84
Well:24
Vector:pOT2
Associated Gene/TranscriptCG32590-RA
Protein status:IP08424.pep: gold
Preliminary Size:718
Sequenced Size:742

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32590 2005-01-01 Successful iPCR screen
CG32590 2008-04-29 Release 5.5 accounting
CG32590 2008-08-15 Release 5.9 accounting
CG32590 2008-12-18 5.12 accounting

Clone Sequence Records

IP08424.complete Sequence

742 bp (742 high quality bases) assembled on 2006-05-24

GenBank Submission: BT025828

> IP08424.complete
AATTAGCCAGTCTGGTTATCGATAACTAGTCCAACTGGAGTCTCGGATGT
AAACAAAACTGAAATAAAAAACAAAAACAAGAGAGTGAATTTAACAATGT
CGCGCGGCAACGAATTGGTATTCAAAGCGAAGAAAACATCAGAGAAGATA
TCGGAGAACATACACATATTCGCCAACGATCCATCGCTGGCGTTTTTCCG
TGTGCAGGAGCACGTTCGCAAGGTTACCCCAGCGATTTTCGAGAAACGCG
ATGAAGTCTTTCAGCTGCAAAATAATCTCCAGGGACATTGCTATGATATG
GAATACGGCATACAAGCGCTGCGAACGATTGAAAAATCGGAGAGCATATT
TGAGAACATCCAGGAAATGATCAAGGCTTCAATATTCCTCAAGCAGCAGC
TAAAGTACGAGGAGAGCAGAAAGAAAGTGAAGAAGGATAGCACCAAATCT
TCCGTCTACAAGCGATTCTCCGCCCATCTGGCACTGGATCTCCCGGATTT
ACCCGATTTCGGTGGCGTTATGCGGGAAACTAGCCAGCGAATGGAGAATA
TGATAGGTCCTGGCACGGCAACAGGACGTACTGAGGCCCAGGCCGCGACA
TCCAGTAATCCTGGCGAGCTCCAACGATCCTATACGACACTCCACTAGAT
TAAGTAGGTTCTAGCATTGTACTCATAGCTATGTATGCATTATTATTCTA
AAATACATTTATTTTAATTGTAAGAAAAAAAAAAAAAAAAAA

IP08424.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG32590-RA 908 CG32590-RA 95..819 1..725 3625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14728588..14728997 724..315 2050 100 Minus
chrX 22417052 chrX 14729054..14729367 314..1 1570 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:55:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14838351..14838761 725..315 2055 100 Minus
X 23542271 X 14838818..14839131 314..1 1570 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 14846449..14846859 725..315 2055 100 Minus
X 23527363 X 14846916..14847229 314..1 1570 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:51:03 has no hits.

IP08424.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:52:09 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14728588..14728997 315..724 100 <- Minus
chrX 14729054..14729367 1..314 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:43 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
CG32590-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:29:56 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
CG32590-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:55:45 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
CG32590-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:00:25 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
CG32590-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:55:25 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
CG32590-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:01:24 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
CG32590-RA 1..724 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:29:55 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
CG32590-RA 1..724 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:55:45 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
CG32590-RA 1..699 26..724 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:00:25 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
CG32590-RA 1..628 97..724 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:55:25 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
CG32590-RA 1..699 26..724 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:09 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
X 14838352..14838761 315..724 100 <- Minus
X 14838818..14839131 1..314 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:09 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
X 14838352..14838761 315..724 100 <- Minus
X 14838818..14839131 1..314 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:09 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
X 14838352..14838761 315..724 100 <- Minus
X 14838818..14839131 1..314 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:55:45 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14732385..14732794 315..724 100 <- Minus
arm_X 14732851..14733164 1..314 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:55:47 Download gff for IP08424.complete
Subject Subject Range Query Range Percent Splice Strand
X 14846450..14846859 315..724 100 <- Minus
X 14846916..14847229 1..314 100   Minus

IP08424.pep Sequence

Translation from 96 to 647

> IP08424.pep
MSRGNELVFKAKKTSEKISENIHIFANDPSLAFFRVQEHVRKVTPAIFEK
RDEVFQLQNNLQGHCYDMEYGIQALRTIEKSESIFENIQEMIKASIFLKQ
QLKYEESRKKVKKDSTKSSVYKRFSAHLALDLPDLPDFGGVMRETSQRME
NMIGPGTATGRTEAQAATSSNPGELQRSYTTLH*

IP08424.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19437-PA 183 GF19437-PA 1..183 1..183 900 90.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19443-PA 183 GG19443-PA 1..183 1..183 945 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13379-PA 178 GH13379-PA 1..178 1..183 709 73.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG32590-PA 183 CG32590-PA 1..183 1..183 930 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19143-PA 180 GL19143-PA 1..180 1..183 724 72.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25537-PA 98 GA25537-PA 1..98 83..183 338 65.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12033-PA 183 GM12033-PA 1..183 1..183 970 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15834-PA 183 GD15834-PA 1..183 1..183 974 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17535-PA 178 GJ17535-PA 1..178 1..183 684 71.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20279-PA 104 GK20279-PA 1..104 68..183 338 61.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16097-PA 183 GE16097-PA 1..183 1..183 943 95.6 Plus

IP08424.hyp Sequence

Translation from 96 to 647

> IP08424.hyp
MSRGNELVFKAKKTSEKISENIHIFANDPSLAFFRVQEHVRKVTPAIFEK
RDEVFQLQNNLQGHCYDMEYGIQALRTIEKSESIFENIQEMIKASIFLKQ
QLKYEESRKKVKKDSTKSSVYKRFSAHLALDLPDLPDFGGVMRETSQRME
NMIGPGTATGRTEAQAATSSNPGELQRSYTTLH*

IP08424.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32590-PA 183 CG32590-PA 1..183 1..183 930 100 Plus