Clone IP08436 Report

Search the DGRC for IP08436

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:84
Well:36
Vector:pOT2
Associated Gene/TranscriptCG33051-RA
Protein status:IP08436.pep: gold
Preliminary Size:636
Sequenced Size:735

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33051 2005-01-01 Successful iPCR screen
CG33051 2008-04-29 Release 5.5 accounting
CG33051 2008-08-15 Release 5.9 accounting
CG33051 2008-12-18 5.12 accounting

Clone Sequence Records

IP08436.complete Sequence

735 bp (735 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022974

> IP08436.complete
CTGAACAATACAATCGGAAATAAGTGTTTCTAAACAGAATACAATAAATT
AAGCATTTATAATGGCAGGCCGCGGAAGGGGCGGCAAGACAGGCACCCTC
ACGGCGGAGCAAATGGCCATGTTGGGATGCACAAAGGATATGCCGGTGCA
GACGGCGCCGCCACCTACATTTCCGCCTGTTTTGAACAGACCCACTACCC
TAGAAACAACAGCCACACAGAACTATCAGCTCCTGTGGAAGGAGGACTTT
CTGAACCGAATGCGAGATTCCCCCTATTACATGATCTCCGCCAGTCGGGA
CGCAAAAAACCTTGATCACAAGGACTGGCGAGAAAAAGCCATGGAGCGCA
TGAAGCTCACAGCACAACCCGATTTTAACTACAAAGCCATGCCCCAAGAG
CTAAACATCTCCAGTCGAAAACGTCGTGGAGCAGATGCAAGGCCGAATCT
GCTGACCAAGAAGACAAACATCGAGGACAGACTGAAGGTTCTGGAGCAGA
AAGAACTGAAATCAGGTGGCGGTGAGCAGGACGAGAACAAACAAGAGTCC
GATTCCGAACAGGAGGAGGAGGAAGATCCGGAGGCGGCGTTGGATGATGA
GATGGACGAGGACAACGACTACGGTGCAACGTACTTTGATAATGGAGAAG
CCTTCAATGATGAGGACGACAACTTGGACGATGGTCCCGTTTACTGAGAC
AAATAAAACCATCGAACTGAAAAAAAAAAAAAAAA

IP08436.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG33051-RA 774 CG33051-RA 53..772 1..720 3600 100 Plus
CG7630-RA 589 CG7630-RA 545..589 720..676 225 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17415769..17416153 719..335 1910 99.7 Minus
chr3L 24539361 chr3L 17416409..17416613 205..1 1025 100 Minus
chr3L 24539361 chr3L 17416211..17416339 334..206 645 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17426285..17426670 720..335 1930 100 Minus
3L 28110227 3L 17426926..17427130 205..1 1025 100 Minus
3L 28110227 3L 17426728..17426856 334..206 645 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17419385..17419770 720..335 1930 100 Minus
3L 28103327 3L 17420026..17420230 205..1 1025 100 Minus
3L 28103327 3L 17419828..17419956 334..206 645 100 Minus
Blast to na_te.dros performed 2019-03-16 07:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 4835..4941 397..504 122 61.8 Plus

IP08436.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:04:07 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17415769..17416153 335..719 99 <- Minus
chr3L 17416211..17416339 206..334 100 <- Minus
chr3L 17416409..17416613 1..205 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:46 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
CG33051-RA 1..636 62..697 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:59:25 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
CG33051-RA 1..636 62..697 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:06:16 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
CG33051-RA 1..636 62..697 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:40:03 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
CG33051-RA 1..636 62..697 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:04 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
CG33051-RA 1..636 62..697 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:41:02 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
CG33051-RA 1..636 62..697 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:59:25 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
CG33051-RA 1..719 1..719 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:16 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
CG33051-RA 1..719 1..719 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:40:03 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
CG33051-RA 1..636 62..697 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:04 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
CG33051-RA 1..719 1..719 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:07 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17426286..17426670 335..719 100 <- Minus
3L 17426728..17426856 206..334 100 <- Minus
3L 17426926..17427130 1..205 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:07 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17426286..17426670 335..719 100 <- Minus
3L 17426728..17426856 206..334 100 <- Minus
3L 17426926..17427130 1..205 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:07 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17426286..17426670 335..719 100 <- Minus
3L 17426728..17426856 206..334 100 <- Minus
3L 17426926..17427130 1..205 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:16 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17419386..17419770 335..719 100 <- Minus
arm_3L 17419828..17419956 206..334 100 <- Minus
arm_3L 17420026..17420230 1..205 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:18:53 Download gff for IP08436.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17419386..17419770 335..719 100 <- Minus
3L 17419828..17419956 206..334 100 <- Minus
3L 17420026..17420230 1..205 100   Minus

IP08436.hyp Sequence

Translation from 61 to 696

> IP08436.hyp
MAGRGRGGKTGTLTAEQMAMLGCTKDMPVQTAPPPTFPPVLNRPTTLETT
ATQNYQLLWKEDFLNRMRDSPYYMISASRDAKNLDHKDWREKAMERMKLT
AQPDFNYKAMPQELNISSRKRRGADARPNLLTKKTNIEDRLKVLEQKELK
SGGGEQDENKQESDSEQEEEEDPEAALDDEMDEDNDYGATYFDNGEAFND
EDDNLDDGPVY*

IP08436.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG33051-PA 211 CG33051-PA 1..211 1..211 1120 100 Plus

IP08436.pep Sequence

Translation from 61 to 696

> IP08436.pep
MAGRGRGGKTGTLTAEQMAMLGCTKDMPVQTAPPPTFPPVLNRPTTLETT
ATQNYQLLWKEDFLNRMRDSPYYMISASRDAKNLDHKDWREKAMERMKLT
AQPDFNYKAMPQELNISSRKRRGADARPNLLTKKTNIEDRLKVLEQKELK
SGGGEQDENKQESDSEQEEEEDPEAALDDEMDEDNDYGATYFDNGEAFND
EDDNLDDGPVY*

IP08436.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24311-PA 212 GF24311-PA 1..212 1..211 773 79.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15813-PA 161 GG15813-PA 13..161 13..211 610 69.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14909-PA 215 GH14909-PA 1..215 1..211 802 75.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG33051-PA 211 CG33051-PA 1..211 1..211 1120 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12885-PA 215 GI12885-PA 1..215 1..211 830 74.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15486-PA 213 GL15486-PA 1..212 1..210 764 72.6 Plus
Dper\GL26515-PA 211 GL26515-PA 1..210 1..210 631 59.9 Plus
Dper\GL21366-PA 162 GL21366-PA 1..161 49..210 460 58.9 Plus
Dper\GL26517-PA 163 GL26517-PA 30..162 92..210 327 51.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23837-PA 213 GA23837-PA 1..212 1..210 764 72.6 Plus
Dpse\GA28895-PA 211 GA28895-PA 1..210 1..210 631 59.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24334-PA 210 GM24334-PA 1..210 1..211 1083 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12407-PA 210 GD12407-PA 1..210 1..211 1083 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13027-PA 215 GJ13027-PA 1..215 1..211 843 77.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20096-PA 216 GK20096-PA 1..216 1..211 721 69.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22152-PA 210 GE22152-PA 1..210 1..211 921 91.9 Plus