Clone IP08456 Report

Search the DGRC for IP08456

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:84
Well:56
Vector:pOT2
Associated Gene/TranscriptCG4271-RA
Protein status:IP08456.pep: validated not full length
Preliminary Size:729
Sequenced Size:763

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4271 2005-01-01 Successful iPCR screen
CG4271 2008-04-29 Release 5.5 accounting
CG4271 2008-08-15 Release 5.9 accounting
CG4271 2008-12-18 5.12 accounting

Clone Sequence Records

IP08456.complete Sequence

763 bp (763 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022986

> IP08456.complete
ATTGGATCCTGTTGGGTGTTGATCTTATTTGCACGAAGCTCCAATGGCAT
CTATAATGGAGTAGAGGCAAAGTTTGACTTCTGGACCTTTCTTGCCTCCG
TGTGGGTAAGTGGATATCATGAGTGCGGCGGTGCTGTGATCGACAGCCGA
ATTGTCCTAACAGCCGCCCAGTGCGTCAAGAATAAGCCGGTGAAGAGAAT
CACAGTCCGTGTGGGAACGCCGGATATCTATAGAGGTGGTAGAATTATCA
GGGTAACAGCGCTGGTGGTTCATGAAAATTATAAGAATTGGGACAACGAT
ATCGCCCTCTTATGGCTAGAGAAGCCAGTGCTTTCCGTACGAGTGACCAA
AATTCCACTGGCCACCAAAGAACCCTCTGAAAACGAATATCCCAGCAATG
CGGGATGGGGCGAAAAACTACTCGAGTCCTACGTCGTGACTAGAAAACTG
CAAAATGGCGTTACCAAAATCCGTCCCCGGAGCATGTGCGCTGAAGAACT
TGTTGAACCGGTTGGCGAGGAACTTCTTTGCGCCTTTTACACCGAAAATG
ATATTTGTCCTGGCGATTATGGAGGTCCCTTGGTCCTGGCCAACAAAGTG
GTTGGCATCGCAGTGCAAGGACACGGCTGCGGGTTTGCCGTTCTGCCATC
ACTTTACACGAACGTCTTCCACTACCTGGAATGGATAGAAGAGAATGCAG
AGAAACTAATCAAAAATAAATAAAAAAAAAATTTTTTAGTTATATGGAAA
AAAAAAAAAAAAA

IP08456.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG4271-RA 729 CG4271-RA 7..729 1..723 3615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2284930..2285676 1..747 3720 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2285180..2285931 1..752 3760 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2285180..2285931 1..752 3760 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:48:36 has no hits.

IP08456.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:49:41 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2284930..2285637 1..708 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:36:52 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG4271-RA 7..729 1..723 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:18:44 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG4271-RA 7..729 1..723 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:58 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG4271-RA 7..729 1..723 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:58 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG4271-RA 7..729 1..723 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:19:04 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG4271-RA 7..729 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:18:46 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG4271-RA 7..729 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:18:44 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG4271-RA 7..753 1..747 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:58 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG4271-RA 18..764 1..747 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:58 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG4271-RA 7..729 1..723 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:19:04 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG4271-RA 18..764 1..747 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:41 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2285180..2285926 1..747 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:41 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2285180..2285926 1..747 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:41 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2285180..2285926 1..747 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:58 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2285180..2285926 1..747 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:38:56 Download gff for IP08456.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2285180..2285926 1..747 100   Plus

IP08456.pep Sequence

Translation from 0 to 722

> IP08456.pep
IGSCWVLILFARSSNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSR
IVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENYKNWDND
IALLWLEKPVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKL
QNGVTKIRPRSMCAEELVEPVGEELLCAFYTENDICPGDYGGPLVLANKV
VGIAVQGHGCGFAVLPSLYTNVFHYLEWIEENAEKLIKNK*

IP08456.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14616-PA 190 GF14616-PA 1..183 27..206 484 50.3 Plus
Dana\GF13692-PA 261 GF13692-PA 35..261 17..237 322 35.1 Plus
Dana\GF12402-PA 256 GF12402-PA 31..256 17..236 292 30.5 Plus
Dana\GF15448-PA 257 GF15448-PA 31..257 17..236 290 29.1 Plus
Dana\GF12548-PA 257 GF12548-PA 48..257 33..236 285 36.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24844-PA 242 GG24844-PA 3..242 1..240 1071 81.2 Plus
Dere\epsilonTry-PA 256 GG22660-PA 31..256 17..236 285 31.3 Plus
Dere\GG20196-PA 252 GG20196-PA 44..252 33..236 280 33.6 Plus
Dere\GG21582-PA 258 GG21582-PA 31..258 17..236 279 32.5 Plus
Dere\GG24539-PA 247 GG24539-PA 14..247 7..236 278 31.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12384-PA 235 GH12384-PA 10..235 17..234 295 31.9 Plus
Dgri\GH13790-PA 261 GH13790-PA 35..259 17..240 291 35.4 Plus
Dgri\GH22926-PA 256 GH22926-PA 31..256 17..236 288 31 Plus
Dgri\GH22928-PA 243 GH22928-PA 28..243 33..236 286 35.2 Plus
Dgri\GH10777-PA 258 GH10777-PA 15..258 1..236 284 29.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG4271-PA 242 CG4271-PA 3..242 1..240 1279 100 Plus
Ser6-PA 259 CG2071-PA 17..258 7..234 305 33.9 Plus
CG17239-PB 248 CG17239-PB 5..248 5..240 304 30.8 Plus
CG17239-PA 248 CG17239-PA 5..248 5..240 304 30.8 Plus
CG1304-PA 260 CG1304-PA 27..258 13..234 295 33.8 Plus
epsilonTry-PA 256 CG18681-PA 31..256 17..236 290 32.2 Plus
CG17571-PB 258 CG17571-PB 31..258 17..236 286 32 Plus
CG17571-PA 258 CG17571-PA 31..258 17..236 286 32 Plus
iotaTry-PA 252 CG7754-PA 44..252 33..236 280 34.3 Plus
CG7829-PA 253 CG7829-PA 18..251 7..235 280 31.9 Plus
betaTry-PB 253 CG18211-PB 31..253 17..233 277 29.6 Plus
betaTry-PA 253 CG18211-PA 31..253 17..233 277 29.6 Plus
CG8299-PA 260 CG8299-PA 22..257 11..234 277 31.9 Plus
etaTry-PA 262 CG12386-PA 59..254 42..229 274 35.7 Plus
CG13430-PB 267 CG13430-PB 32..267 17..237 271 32.6 Plus
CG13430-PA 267 CG13430-PA 32..267 17..237 271 32.6 Plus
CG31954-PA 277 CG31954-PA 73..275 40..233 271 33 Plus
thetaTry-PA 262 CG12385-PA 56..262 37..236 268 31.9 Plus
CG4653-PA 254 CG4653-PA 45..253 37..233 267 35.8 Plus
alphaTry-PA 256 CG18444-PA 31..256 17..236 266 28.8 Plus
gammaTry-PA 253 CG30028-PA 31..253 17..233 260 28.7 Plus
CG30025-PA 253 CG30025-PA 31..253 17..233 260 28.7 Plus
deltaTry-PA 253 CG12351-PA 31..253 17..233 260 28.7 Plus
CG30031-PA 253 CG30031-PA 31..253 17..233 260 28.7 Plus
CG16998-PA 258 CG16998-PA 25..242 17..229 253 32.1 Plus
Ser8-PA 260 CG4812-PA 35..253 17..229 245 29.1 Plus
CG32374-PA 299 CG32374-PA 74..298 17..235 245 30 Plus
sphe-PA 249 CG9675-PA 26..246 17..231 244 28.3 Plus
CG31681-PA 264 CG31681-PA 29..257 17..237 244 30.7 Plus
CG3795-PB 305 CG3795-PB 77..282 40..233 241 34.1 Plus
CG3795-PA 305 CG3795-PA 77..282 40..233 241 34.1 Plus
CG11192-PB 279 CG11192-PB 28..264 17..234 237 31.2 Plus
CG9673-PB 261 CG9673-PB 17..261 7..234 236 32.7 Plus
CG9673-PA 261 CG9673-PA 17..261 7..234 236 32.7 Plus
CG7432-PB 721 CG7432-PB 471..718 13..232 236 28.9 Plus
CG32376-PA 291 CG32376-PA 48..290 13..235 235 30.9 Plus
CG32755-PA 315 CG32755-PA 69..271 40..229 234 34.3 Plus
CG9672-PA 253 CG9672-PA 16..253 8..235 233 29.2 Plus
Ser12-PA 245 CG17240-PA 39..245 32..236 232 32.1 Plus
CG9897-PA 247 CG9897-PA 15..246 5..234 230 29.3 Plus
CG9372-PA 408 CG9372-PA 177..407 20..234 230 31.8 Plus
CG33159-PA 257 CG33159-PA 22..255 13..236 229 29.5 Plus
CG34458-PA 257 CG34458-PA 48..255 33..233 229 27.8 Plus
CG32523-PA 262 CG32523-PA 37..260 17..233 228 31 Plus
CG16749-PA 265 CG16749-PA 30..260 17..232 228 28 Plus
Send1-PA 255 CG17012-PA 51..239 38..229 226 32.8 Plus
CG9676-PA 251 CG9676-PA 28..249 17..233 225 29.8 Plus
CG11836-PI 281 CG11836-PI 38..275 10..234 222 29.6 Plus
CG11836-PJ 333 CG11836-PJ 90..327 10..234 222 29.6 Plus
CG11836-PF 223 CG11836-PF 1..217 31..234 217 31.1 Plus
CG11836-PE 223 CG11836-PE 1..217 31..234 217 31.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14724-PA 252 GI14724-PA 22..251 11..232 291 34.5 Plus
Dmoj\GI17438-PA 258 GI17438-PA 28..258 10..236 284 32.1 Plus
Dmoj\GI17437-PA 238 GI17437-PA 8..238 10..236 283 32.1 Plus
Dmoj\GI18353-PA 254 GI18353-PA 45..251 33..232 280 33.3 Plus
Dmoj\GI21243-PA 255 GI21243-PA 31..255 17..236 278 29.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17338-PA 256 GL17338-PA 31..256 17..236 303 33 Plus
Dper\GL20660-PA 260 GL20660-PA 15..256 7..233 292 33.5 Plus
Dper\GL26041-PA 259 GL26041-PA 29..259 10..236 284 30.9 Plus
Dper\GL17144-PA 252 GL17144-PA 27..252 17..236 279 33.8 Plus
Dper\GL17339-PA 256 GL17339-PA 51..256 37..236 275 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15051-PA 256 GA15051-PA 31..256 17..236 310 33 Plus
Dpse\GA11598-PA 262 GA11598-PA 57..257 40..232 298 36.1 Plus
Dpse\GA20967-PA 260 GA20967-PA 15..256 7..233 292 33.5 Plus
Dpse\GA23343-PA 259 GA23343-PA 29..259 10..236 282 30.9 Plus
Dpse\GA20562-PA 252 GA20562-PA 27..252 17..236 280 33.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18329-PA 242 GM18329-PA 3..242 1..240 1181 92.5 Plus
Dsec\GM20107-PA 260 GM20107-PA 22..260 11..237 284 32 Plus
Dsec\GM18246-PA 248 GM18246-PA 39..248 32..240 283 32.2 Plus
Dsec\GM22650-PA 259 GM22650-PA 17..258 7..234 282 33.5 Plus
Dsec\GM12217-PA 294 GM12217-PA 59..288 7..231 278 31.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23144-PA 242 GD23144-PA 3..242 1..240 1191 93.3 Plus
Dsim\GD22852-PA 248 GD22852-PA 39..248 32..240 301 32.7 Plus
Dsim\GD21711-PA 258 GD21711-PA 31..258 17..236 296 32.5 Plus
Dsim\GD15519-PA 259 GD15519-PA 17..258 7..234 281 33.9 Plus
Dsim\GD25584-PA 260 GD25584-PA 22..260 11..237 279 32 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20753-PA 258 GJ20753-PA 24..250 10..229 332 36.1 Plus
Dvir\GJ20850-PA 261 GJ20850-PA 55..261 37..236 294 36.2 Plus
Dvir\GJ20754-PA 253 GJ20754-PA 40..250 33..236 292 31.3 Plus
Dvir\GJ18704-PA 236 GJ18704-PA 10..236 17..234 277 33.6 Plus
Dvir\GJ20851-PA 269 GJ20851-PA 63..264 40..232 270 36.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25506-PA 256 GK25506-PA 29..254 17..233 310 36.1 Plus
Dwil\GK21994-PA 256 GK21994-PA 31..256 17..236 300 32.2 Plus
Dwil\GK10310-PA 262 GK10310-PA 29..259 17..234 292 33.8 Plus
Dwil\GK19007-PA 261 GK19007-PA 36..254 17..229 288 34.5 Plus
Dwil\GK19332-PA 264 GK19332-PA 56..256 40..231 277 34.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18095-PA 242 GE18095-PA 3..241 1..239 1107 84.9 Plus
Dyak\epsilonTry-PA 256 GE13534-PA 31..256 17..236 301 32.2 Plus
Dyak\GE15326-PA 259 GE15326-PA 17..258 7..234 296 33.9 Plus
Dyak\GE10423-PA 253 GE10423-PA 13..252 1..235 286 32 Plus
Dyak\GE12601-PA 258 GE12601-PA 31..258 17..236 284 32 Plus

IP08456.hyp Sequence

Translation from 0 to 722

> IP08456.hyp
IGSCWVLILFARSSNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSR
IVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENYKNWDND
IALLWLEKPVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKL
QNGVTKIRPRSMCAEELVEPVGEELLCAFYTENDICPGDYGGPLVLANKV
VGIAVQGHGCGFAVLPSLYTNVFHYLEWIEENAEKLIKNK*

IP08456.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG4271-PA 242 CG4271-PA 3..242 1..240 1279 100 Plus
Ser6-PA 259 CG2071-PA 17..258 7..234 305 33.9 Plus
CG17239-PB 248 CG17239-PB 5..248 5..240 304 30.8 Plus
CG17239-PA 248 CG17239-PA 5..248 5..240 304 30.8 Plus
CG1304-PA 260 CG1304-PA 27..258 13..234 295 33.8 Plus