Clone IP08469 Report

Search the DGRC for IP08469

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:84
Well:69
Vector:pOT2
Associated Gene/TranscriptCG7849-RB
Protein status:IP08469.pep: gold
Preliminary Size:954
Sequenced Size:1070

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7849 2005-01-01 Successful iPCR screen
CG7849 2008-04-29 Release 5.5 accounting
CG7849 2008-08-15 Release 5.9 accounting
CG7849 2008-12-18 5.12 accounting

Clone Sequence Records

IP08469.complete Sequence

1070 bp (1070 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024356

> IP08469.complete
CACATACGTAACTTAAAGCAGAAATGGCTCTCACCAAAGTTTATGATGCC
GCCACAGTGTTTAAGCACATGAATGGCATTCTAAATGTGTACAAGCCATC
CGGTATGAAGGTGAAACACGTGCGCAATGCTATTCTGAGCAACATTTGCA
AGGGACTCAACGAAATGGAGCAGAGGAAACCACGCAAGTTGCAAGAGAAC
ATTAGCCTCCTGGGCACAGGCACTGCAGCAGATCACGTACTACATAACAT
AGGAGAGCAGACGGATCTATCCGACCACCTTCTGTCCACCGGACCGCGGT
ACCTTCCGCGAGACTTGATCTGCACCACAGTGTCCAGCCTGGGCGATCAC
ACCAGCGGAGTCCTGCTCTTTGGGATCAACAGGGGAGCAGGCCAGTCTAG
TTCTATTCGGAAAAATCGACCAGTGCGGGTCTACCATCTAATCGGGCACC
TAGGCATCGCAACCGAAAATAACCTACCAGACTCACGGGTCATAATGCGC
TCCAATCACCGACACGTGTCCGCAGACAGGATCAGCAGTCTAGCCGCCTC
CATGCAGGCATCCCATCAGCGTAAGATGTTTGAGCTCTGCGGTGTCGATT
TGCAGACCCAGGAGGCCTATGAACTGGCCTGTAGGGGTCTCCTACGCCCA
GCGGACGACAGTCAGCCCGTCGTCTACGGCATTAAGCTGATTCACTTCGA
TCGACCGCACTTCACCCTGGAACTGCACGCCATCAACGAGACGCAGGAGT
ACTTAGCTACGCTAGTGCACGATATGGCTTTGGACCTCCGAACCGTGGCG
CACTGCTCCCAACTACGCTGCGTGCGGCATGCCCATTTTGATGTGACAGA
TAGTCTGCTCAGACACGCCTGGCACTTGCCAGGAATTATCAAGAACCTCC
GTCAACAACGTGACATCCTGAGGGCGCATCCACAGCTTCTGCGACAACAG
CGAGTGGAACTGCGAGCTACAGATTAATTTAGGAATTCATTGTAATTGAA
TATAGTCAAATAAATATAGGCAGATAAACTATAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

IP08469.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG7849-RB 1268 CG7849-RB 189..1223 1..1035 5175 100 Plus
CG7849.a 1086 CG7849.a 207..1086 153..1032 4400 100 Plus
CG7849-RA 741 CG7849-RA 131..741 367..977 3055 100 Plus
CG7849.a 1086 CG7849.a 44..196 1..153 765 100 Plus
CG7849-RA 741 CG7849-RA 1..130 24..153 650 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1964554..1965219 367..1032 3330 100 Plus
chr2R 21145070 chr2R 1964291..1964504 153..366 1040 99.1 Plus
chr2R 21145070 chr2R 1964084..1964237 1..154 770 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6077423..6078091 367..1035 3345 100 Plus
2R 25286936 2R 6077160..6077373 153..366 1070 100 Plus
2R 25286936 2R 6076953..6077106 1..154 770 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6078622..6079290 367..1035 3345 100 Plus
2R 25260384 2R 6078359..6078572 153..366 1070 100 Plus
2R 25260384 2R 6078152..6078305 1..154 770 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:42:01 has no hits.

IP08469.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:43:04 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1964084..1964236 1..153 100 -> Plus
chr2R 1964292..1964504 154..366 99 -> Plus
chr2R 1964554..1965219 367..1032 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:03 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7849-RB 1..954 24..977 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:37:45 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7849-RB 1..954 24..977 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:06 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7849-RB 1..954 24..977 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:12:43 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7849-RB 1..954 24..977 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:12:07 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7849-RB 1..954 24..977 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:09:35 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7849-RB 1..954 24..977 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:37:45 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7849-RB 44..1075 1..1032 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:06 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7849-RB 44..1075 1..1032 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:12:44 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7849-RB 1..954 24..977 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:12:07 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7849-RB 44..1075 1..1032 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:43:04 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6077161..6077373 154..366 100 -> Plus
2R 6076953..6077105 1..153 100 -> Plus
2R 6077423..6078088 367..1032 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:43:04 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6077161..6077373 154..366 100 -> Plus
2R 6076953..6077105 1..153 100 -> Plus
2R 6077423..6078088 367..1032 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:43:04 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6077161..6077373 154..366 100 -> Plus
2R 6076953..6077105 1..153 100 -> Plus
2R 6077423..6078088 367..1032 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:06 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1964666..1964878 154..366 100 -> Plus
arm_2R 1964458..1964610 1..153 100 -> Plus
arm_2R 1964928..1965593 367..1032 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:00:52 Download gff for IP08469.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6078360..6078572 154..366 100 -> Plus
2R 6078622..6079287 367..1032 100   Plus
2R 6078152..6078304 1..153 100 -> Plus

IP08469.pep Sequence

Translation from 23 to 976

> IP08469.pep
MALTKVYDAATVFKHMNGILNVYKPSGMKVKHVRNAILSNICKGLNEMEQ
RKPRKLQENISLLGTGTAADHVLHNIGEQTDLSDHLLSTGPRYLPRDLIC
TTVSSLGDHTSGVLLFGINRGAGQSSSIRKNRPVRVYHLIGHLGIATENN
LPDSRVIMRSNHRHVSADRISSLAASMQASHQRKMFELCGVDLQTQEAYE
LACRGLLRPADDSQPVVYGIKLIHFDRPHFTLELHAINETQEYLATLVHD
MALDLRTVAHCSQLRCVRHAHFDVTDSLLRHAWHLPGIIKNLRQQRDILR
AHPQLLRQQRVELRATD*

IP08469.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11045-PA 314 GF11045-PA 1..314 1..315 1276 72.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23194-PA 317 GG23194-PA 1..317 1..317 1595 94 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20932-PA 317 GH20932-PA 1..315 1..315 1338 75.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG7849-PB 317 CG7849-PB 1..317 1..317 1647 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18369-PA 317 GI18369-PA 1..316 1..316 1318 74.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11803-PA 315 GL11803-PA 1..315 1..315 1359 77.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24084-PA 315 GA24084-PA 1..315 1..315 1364 77.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16534-PA 317 GM16534-PA 1..317 1..317 1642 96.5 Plus
Dsec\GM13571-PA 317 GM13571-PA 1..317 1..317 1642 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10395-PA 317 GD10395-PA 1..317 1..317 1644 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21442-PA 318 GJ21442-PA 1..315 1..315 1305 76.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21329-PA 65 GK21329-PA 1..63 251..313 271 69.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20703-PA 317 GE20703-PA 1..317 1..317 1533 91.2 Plus

IP08469.hyp Sequence

Translation from 23 to 976

> IP08469.hyp
MALTKVYDAATVFKHMNGILNVYKPSGMKVKHVRNAILSNICKGLNEMEQ
RKPRKLQENISLLGTGTAADHVLHNIGEQTDLSDHLLSTGPRYLPRDLIC
TTVSSLGDHTSGVLLFGINRGAGQSSSIRKNRPVRVYHLIGHLGIATENN
LPDSRVIMRSNHRHVSADRISSLAASMQASHQRKMFELCGVDLQTQEAYE
LACRGLLRPADDSQPVVYGIKLIHFDRPHFTLELHAINETQEYLATLVHD
MALDLRTVAHCSQLRCVRHAHFDVTDSLLRHAWHLPGIIKNLRQQRDILR
AHPQLLRQQRVELRATD*

IP08469.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG7849-PB 317 CG7849-PB 1..317 1..317 1647 100 Plus