Clone IP08534 Report

Search the DGRC for IP08534

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:85
Well:34
Vector:pOT2
Associated Gene/TranscriptCG3288-RA
Protein status:IP08534.pep: gold
Preliminary Size:681
Sequenced Size:811

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3288 2005-01-01 Successful iPCR screen
CG3288 2008-04-29 Release 5.5 accounting
CG3288 2008-08-15 Release 5.9 accounting
CG3288 2008-12-18 5.12 accounting

Clone Sequence Records

IP08534.complete Sequence

811 bp (811 high quality bases) assembled on 2005-01-13

GenBank Submission: BT023026

> IP08534.complete
TGAGTTAGCACTTCCGGATCAGCGACCCCATGTTTCTGGACGCCATCTTC
TTTATACCGACACTGTTCACTTACCTGCTTATCGGACTGCTCATCGTCAT
CCTGTGCTTCGTGGTGGTCTATATCAGCCACAAGATCTATGTCTCCGTCT
ACGACAACCTGCCTCTGGCCGCCTTGCCCGGCAACTCACGGCAACAGCTC
CTGGGACTGCGTCACTCCAATCATGCGATGACCATACGGGAATACCTGGA
CAGCTCGCTCCGCAGCCCACGTTCCAATCAGCCGAGCTTACGGTCAGTTT
GGATTCAGAACCGGTCACAGATCCTGGAGACCTCTTCGGTGATGCGTATA
GTGCTCTCCCTGGAGCCCTGCTACCTGGTCAGCGCCGAGTTCGATGTTAG
TTCCAGCCGGAAGGCCATCAGTTTCTTGTGCAACTGCCGGGATCAGCCCG
TGTGTGCTGCCTCTGAACCGAGGCCTTCTGGGTCCTTGCATATAGTGCGG
TTCTATGACCACCTCTCCAAGATCCCGCGCCTCAAAGTCATGCTCAAGTG
TAACCAAAGGCGGCCGGACCCGAGGCCGGACAGTCGTATCCAGTTGACCC
TCGACGACGTGATCCAGGAGGCCAGAGATAACCAGGATGCCAGGTGTACG
GATAACGCCGCCGCCTGCCGACCTGGTTCCTCAAGGCGGAACTCCCGGAT
ACCGGATTAAAGGATAGGGGGGTATACGTCGTCTGTTCTGGGCTGCTTGG
TCGCGGTATAACTAGTTTTATTAAATTGTATACAAAGATCAAAAAAAAAA
AAAAAAAAAAA

IP08534.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3288.a 988 CG3288.a 38..829 1..792 3960 100 Plus
CG3288-RA 827 CG3288-RA 38..827 1..790 3950 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20825605..20826056 339..790 2260 100 Plus
chr3L 24539361 chr3L 20825203..20825541 1..339 1695 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20836584..20837037 339..792 2270 100 Plus
3L 28110227 3L 20836182..20836520 1..339 1695 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20829684..20830137 339..792 2270 100 Plus
3L 28103327 3L 20829282..20829620 1..339 1695 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:51:28 has no hits.

IP08534.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:52:07 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20825203..20825541 1..339 100 -> Plus
chr3L 20825606..20826056 340..790 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:12 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
CG3288-RA 1..681 30..710 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:15 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
CG3288-RA 1..681 30..710 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:52:34 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
CG3288-RA 1..681 30..710 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:57:46 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
CG3288-RA 1..681 30..710 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:02:47 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
CG3288-RA 1..681 30..710 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:09:23 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
CG3288-RA 1..681 30..710 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:15 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
CG3288-RA 1..790 1..790 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:52:34 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
CG3288-RA 1..790 1..790 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:57:46 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
CG3288-RA 1..681 30..710 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:02:47 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
CG3288-RA 1..790 1..790 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:52:07 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20836182..20836520 1..339 100 -> Plus
3L 20836585..20837035 340..790 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:52:07 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20836182..20836520 1..339 100 -> Plus
3L 20836585..20837035 340..790 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:52:07 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20836182..20836520 1..339 100 -> Plus
3L 20836585..20837035 340..790 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:52:34 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20829282..20829620 1..339 100 -> Plus
arm_3L 20829685..20830135 340..790 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:12 Download gff for IP08534.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20829282..20829620 1..339 100 -> Plus
3L 20829685..20830135 340..790 100   Plus

IP08534.pep Sequence

Translation from 29 to 709

> IP08534.pep
MFLDAIFFIPTLFTYLLIGLLIVILCFVVVYISHKIYVSVYDNLPLAALP
GNSRQQLLGLRHSNHAMTIREYLDSSLRSPRSNQPSLRSVWIQNRSQILE
TSSVMRIVLSLEPCYLVSAEFDVSSSRKAISFLCNCRDQPVCAASEPRPS
GSLHIVRFYDHLSKIPRLKVMLKCNQRRPDPRPDSRIQLTLDDVIQEARD
NQDARCTDNAAACRPGSSRRNSRIPD*

IP08534.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24287-PA 223 GF24287-PA 1..216 1..223 723 71.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16144-PA 225 GG16144-PA 1..225 1..226 1136 96.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15910-PA 204 GH15910-PA 1..191 1..213 376 47.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG3288-PB 226 CG3288-PB 1..226 1..226 1165 100 Plus
CG3288-PA 226 CG3288-PA 1..226 1..226 1165 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16564-PA 209 GI16564-PA 1..201 1..220 448 47.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24363-PA 231 GL24363-PA 7..191 1..176 448 52.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17192-PA 231 GA17192-PA 7..191 1..176 438 51 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22326-PA 226 GM22326-PA 1..226 1..226 1162 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14915-PA 226 GD14915-PA 1..226 1..226 1169 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12815-PA 199 GJ12815-PA 1..195 1..213 398 45.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25354-PA 248 GK25354-PA 1..211 1..221 566 58 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19714-PA 226 GE19714-PA 1..226 1..226 1150 96.9 Plus

IP08534.hyp Sequence

Translation from 29 to 709

> IP08534.hyp
MFLDAIFFIPTLFTYLLIGLLIVILCFVVVYISHKIYVSVYDNLPLAALP
GNSRQQLLGLRHSNHAMTIREYLDSSLRSPRSNQPSLRSVWIQNRSQILE
TSSVMRIVLSLEPCYLVSAEFDVSSSRKAISFLCNCRDQPVCAASEPRPS
GSLHIVRFYDHLSKIPRLKVMLKCNQRRPDPRPDSRIQLTLDDVIQEARD
NQDARCTDNAAACRPGSSRRNSRIPD*

IP08534.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG3288-PB 226 CG3288-PB 1..226 1..226 1165 100 Plus
CG3288-PA 226 CG3288-PA 1..226 1..226 1165 100 Plus