Clone IP08537 Report

Search the DGRC for IP08537

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:85
Well:37
Vector:pOT2
Associated Gene/TranscriptCG33093-RA
Protein status:IP08537.pep: gold
Preliminary Size:636
Sequenced Size:1084

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33093 2005-01-01 Successful iPCR screen
CG33093 2008-04-29 Release 5.5 accounting
CG33093 2008-08-15 Release 5.9 accounting
CG33093 2008-12-18 5.12 accounting

Clone Sequence Records

IP08537.complete Sequence

1084 bp (1084 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023030

> IP08537.complete
GTTGGAATAAGTTCACTTGATAAGATACTTTTTTAAACAATGAAATCAGA
AACTGAGACTCTGCTCTTGCAAAATGCTGTTCCTATAATAGATTTAGAAA
ATACCATCGAGGACGTGGCGACAAATCTGAGAGAGGCTTTATCTGAAAAG
GGGTATGCTCTGCTAATAAACCACGGTATTTCAAATGAGAAGATTAAAAA
AGCTTGGAAGTATTTCGATGGCTTTGTCGACCTGACCGATGAAGTTAAAT
TGGCATTTGAGAGAAGCAAAGCTCCAGATGGCGAAAATCATGGTTACGTG
AGTCCAGGAATGGAGCGATTTGATGGCAGGACACCGGAGCTGCGCCATGC
TTACAATATATGCAAGCTGCAGGATAAATTTCTGCCTGAACAGCAGCTAC
CAGGATTTAGCAGGCACATTAACTCCTTAGTCGATGACTTCAATGAATTG
GGTAGGTTTATTCTTAAGGCTCTGGCAATTTCATTGGATGCTCCACCTTC
GTTCTTCACGGATAAACATTCGTTTATGCTGTCCGACGATCGCTTTAATC
TGACCACCCTACGGATGCTGTTTTACCCGCCCGTGGAAGATCAGGATCAT
GGAAGAAGCTTCATACGATGTGGAGCCCATGCCGACTACTGCACCTTTAC
TCTGTTGGCTCAGGATTCGGAGGGTGGATTGGAGGTCAAACTGCGGGGCA
GTGACAAGTGGGAGCGAGTGGGTCATCTGCCAGGAGCACTCTTCATAAAC
TGCGGTGAAACCATGGCTATCTGGACAGATCAGTTCTACCACGCTTTGCA
ACATAGAGTAGTGATTCCCGATCAGGTTGATATTCGCCATCGAGGCCGGC
ACTCCATTGCCTATTTCTGTCATCCTGATAACTCTGCACTGATTAATCCA
AAAGATTTAAATATTACAACTAAGCAGACGACAAGTGACGTAATACAAAA
CGCATATGATATAACTATGGCTCTGGCAAAAGGCGCATTTGCACATCATT
ATTCTTAGCAAGATACTTTAATATTTAATAAATTGTAGTTATTGCATGTT
TTCTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP08537.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG33093-RA 1234 CG33093-RA 95..1151 1..1057 5285 100 Plus
CG33093.b 1053 CG33093.b 1..1053 1..1055 5220 99.8 Plus
CG33093.a 1213 CG33093.a 3..800 1..798 3990 100 Plus
CG33093.a 1213 CG33093.a 857..1116 798..1057 1300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18354619..18355226 798..191 3040 100 Minus
chr3R 27901430 chr3R 18355279..18355470 192..1 960 100 Minus
chr3R 27901430 chr3R 18354419..18354562 941..798 720 100 Minus
chr3R 27901430 chr3R 18354242..18354355 1055..942 570 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22531071..22531678 798..191 3040 100 Minus
3R 32079331 3R 22531731..22531922 192..1 960 100 Minus
3R 32079331 3R 22530871..22531014 941..798 720 100 Minus
3R 32079331 3R 22530692..22530807 1057..942 580 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22271902..22272509 798..191 3040 100 Minus
3R 31820162 3R 22272562..22272753 192..1 960 100 Minus
3R 31820162 3R 22271702..22271845 941..798 720 100 Minus
3R 31820162 3R 22271523..22271638 1057..942 580 100 Minus
3R 31820162 3R 22270651..22270734 369..286 165 79.7 Minus
Blast to na_te.dros performed on 2019-03-15 15:39:56 has no hits.

IP08537.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:41:10 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18354242..18354355 942..1055 100 <- Minus
chr3R 18354419..18354561 799..941 100 <- Minus
chr3R 18354619..18355224 193..798 100 <- Minus
chr3R 18355279..18355470 1..192 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:13 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33093-RA 1..969 40..1008 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:18:21 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33093-RA 1..969 40..1008 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:35:41 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33093-RA 1..969 40..1008 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:39 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33093-RA 1..969 40..1008 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:13 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33093-RA 1..969 40..1008 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:18:12 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33093-RA 1..1055 1..1055 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:18:21 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33093-RA 1..1055 1..1055 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:35:41 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33093-RA 1..1055 1..1055 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:39 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33093-RA 1..1055 1..1055 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:13 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33093-RA 1..1055 1..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:10 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22530694..22530807 942..1055 100 <- Minus
3R 22530871..22531013 799..941 100 <- Minus
3R 22531071..22531676 193..798 100 <- Minus
3R 22531731..22531922 1..192 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:10 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22530694..22530807 942..1055 100 <- Minus
3R 22530871..22531013 799..941 100 <- Minus
3R 22531071..22531676 193..798 100 <- Minus
3R 22531731..22531922 1..192 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:10 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22530694..22530807 942..1055 100 <- Minus
3R 22530871..22531013 799..941 100 <- Minus
3R 22531071..22531676 193..798 100 <- Minus
3R 22531731..22531922 1..192 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:35:41 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18356416..18356529 942..1055 100 <- Minus
arm_3R 18356593..18356735 799..941 100 <- Minus
arm_3R 18356793..18357398 193..798 100 <- Minus
arm_3R 18357453..18357644 1..192 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:38:31 Download gff for IP08537.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22271902..22272507 193..798 100 <- Minus
3R 22272562..22272753 1..192 100   Minus
3R 22271525..22271638 942..1055 100 <- Minus
3R 22271702..22271844 799..941 100 <- Minus

IP08537.pep Sequence

Translation from 39 to 1007

> IP08537.pep
MKSETETLLLQNAVPIIDLENTIEDVATNLREALSEKGYALLINHGISNE
KIKKAWKYFDGFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPE
LRHAYNICKLQDKFLPEQQLPGFSRHINSLVDDFNELGRFILKALAISLD
APPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDHGRSFIRCGAHADY
CTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFY
HALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQTTSD
VIQNAYDITMALAKGAFAHHYS*

IP08537.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16149-PA 319 GF16149-PA 2..319 6..322 1167 66.4 Plus
Dana\GF16150-PA 330 GF16150-PA 12..317 6..308 902 53.7 Plus
Dana\GF16151-PA 404 GF16151-PA 12..357 6..290 837 48.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12508-PA 331 GG12508-PA 12..317 6..308 919 56 Plus
Dere\GG12509-PA 403 GG12509-PA 12..356 6..290 822 48 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17399-PA 408 GH17399-PA 12..373 6..303 892 50.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG33093-PA 322 CG33093-PA 1..322 1..322 1712 100 Plus
CG33099-PA 331 CG33099-PA 8..317 2..308 908 55.9 Plus
CG5346-PA 403 CG5346-PA 12..356 6..290 800 47.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22727-PA 405 GI22727-PA 12..371 6..303 911 51.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13684-PA 342 GL13684-PA 7..323 1..308 927 56.9 Plus
Dper\GL13685-PA 403 GL13685-PA 12..357 6..290 821 47.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26989-PA 344 GA26989-PA 7..325 1..308 927 56.8 Plus
Dpse\GA18819-PA 403 GA18819-PA 12..357 6..290 821 47.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23640-PA 322 GM23640-PA 1..322 1..322 1615 91.3 Plus
Dsec\GM23643-PA 403 GM23643-PA 12..356 6..290 816 47.4 Plus
Dsec\GM23642-PA 180 GM23642-PA 1..179 145..321 556 57.5 Plus
Dsec\GM23641-PA 118 GM23641-PA 8..111 2..104 269 51.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18450-PA 284 GD18450-PA 1..284 1..301 1396 86.4 Plus
Dsim\GD18451-PA 331 GD18451-PA 12..317 6..308 937 57 Plus
Dsim\GD18452-PA 403 GD18452-PA 12..356 6..290 816 47.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24665-PA 408 GJ24665-PA 12..373 6..303 912 51.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14435-PA 315 GK14435-PA 2..295 5..290 866 55.4 Plus
Dwil\GK14437-PA 404 GK14437-PA 12..356 6..290 831 49.7 Plus
Dwil\GK14436-PA 332 GK14436-PA 12..298 6..290 824 54.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24029-PA 321 GE24029-PA 1..321 1..322 1473 83.9 Plus
Dyak\GE24030-PA 331 GE24030-PA 12..317 6..308 929 56.3 Plus
Dyak\GE24031-PA 403 GE24031-PA 12..356 6..290 824 48 Plus

IP08537.hyp Sequence

Translation from 39 to 1007

> IP08537.hyp
MKSETETLLLQNAVPIIDLENTIEDVATNLREALSEKGYALLINHGISNE
KIKKAWKYFDGFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPE
LRHAYNICKLQDKFLPEQQLPGFSRHINSLVDDFNELGRFILKALAISLD
APPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDHGRSFIRCGAHADY
CTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFY
HALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQTTSD
VIQNAYDITMALAKGAFAHHYS*

IP08537.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG33093-PA 322 CG33093-PA 1..322 1..322 1712 100 Plus
CG33099-PA 331 CG33099-PA 8..317 2..308 908 55.9 Plus
CG5346-PA 403 CG5346-PA 12..356 6..290 800 47.4 Plus