Clone IP08562 Report

Search the DGRC for IP08562

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:85
Well:62
Vector:pOT2
Associated Gene/TranscriptCG5388-RA
Protein status:IP08562.pep: gold
Preliminary Size:647
Sequenced Size:651

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5388 2005-01-01 Successful iPCR screen
CG5388 2008-04-29 Release 5.5 accounting
CG5388 2008-08-15 Release 5.9 accounting
CG5388 2008-12-18 5.12 accounting

Clone Sequence Records

IP08562.complete Sequence

651 bp (651 high quality bases) assembled on 2005-01-13

GenBank Submission: BT023038

> IP08562.complete
ATTTGTTAATATCAAAGTAAGTCTTCCAAATCTGAAGTTCGCAGTAGGTC
CTGGCAGTCAAAACTGAAATTGAATTGGATGTGGTTGTGACTCCGACCCT
CTGACGTCTTGCAGATATTAATTTGAAATGCCTCCTGTTGAAGTGAGCAT
ACGCCAAGGAGTTGCGTTTTTGGGCTTGTATGTGCTGCTCCTGGCTGCTT
TGGTGCGTCCCCAGATGAACTTCAGCATATTCGTGGACTCGTTCTTCCTG
CAGGTCAATCACTCGGTGGTAATGGTGCTGAGCTACCGGTTTGATTCCTA
TATGGCGATGGCCGCCGCACCACTCAGTGCCGTTACGGTGTTTGCCCTTT
CCAAGTGGAACGAACGTTGCGAGAATCCCTCCTCCAGGAAGCTAGTGATC
ATGGGCGTGACATGCTTGTATGTCTTGGTGCTGGTGGCCAATGTCCTGGC
CAATGGAATAGTGGTTCAGCAGGCGTTGATCCGCTTCGATCAATGTCCGT
ATCGGGCGTGGTATATGTACAGCCAGATGGCCATGTCCTTTATCAAATCC
TCGATTGCAGAAGTCCAGGAAGTTTTCACCGGACGGCCTCAACGTCGGTC
CCGACTTATATATCGTTTGCATTAGGTACAGCCAAAAAAAAAAAAAAAAA
A

IP08562.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG5388-RA 799 CG5388-RA 81..723 1..643 3215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18160708..18161224 633..117 2450 98.3 Minus
chr3R 27901430 chr3R 18163755..18163870 116..1 580 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22337104..22337630 643..117 2635 100 Minus
3R 32079331 3R 22340165..22340280 116..1 580 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22077935..22078461 643..117 2635 100 Minus
3R 31820162 3R 22080996..22081111 116..1 580 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:57:20 has no hits.

IP08562.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:58:10 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18160708..18161224 117..633 98 <- Minus
chr3R 18163755..18163870 1..116 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:15 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
CG5388-RA 1..498 128..625 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:52:50 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
CG5388-RA 1..498 128..625 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:01:10 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
CG5388-RA 1..498 128..625 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:37:28 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
CG5388-RA 1..498 128..625 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:26:52 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
CG5388-RA 1..498 128..625 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:35:12 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
CG5388-RA 23..647 1..625 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:52:50 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
CG5388-RA 28..660 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:01:10 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
CG5388-RA 28..660 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:37:28 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
CG5388-RA 23..647 1..625 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:26:52 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
CG5388-RA 28..660 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:10 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22337114..22337630 117..633 100 <- Minus
3R 22340165..22340280 1..116 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:10 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22337114..22337630 117..633 100 <- Minus
3R 22340165..22340280 1..116 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:10 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22337114..22337630 117..633 100 <- Minus
3R 22340165..22340280 1..116 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:01:10 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18162836..18163352 117..633 100 <- Minus
arm_3R 18165887..18166002 1..116 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:12:07 Download gff for IP08562.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22077945..22078461 117..633 100 <- Minus
3R 22080996..22081111 1..116 100   Minus

IP08562.pep Sequence

Translation from 127 to 624

> IP08562.pep
MPPVEVSIRQGVAFLGLYVLLLAALVRPQMNFSIFVDSFFLQVNHSVVMV
LSYRFDSYMAMAAAPLSAVTVFALSKWNERCENPSSRKLVIMGVTCLYVL
VLVANVLANGIVVQQALIRFDQCPYRAWYMYSQMAMSFIKSSIAEVQEVF
TGRPQRRSRLIYRLH*

IP08562.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19894-PA 164 GF19894-PA 1..164 4..165 458 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12528-PA 165 GG12528-PA 1..165 1..165 668 90.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG5388-PB 165 CG5388-PB 1..165 1..165 831 100 Plus
CG5388-PA 165 CG5388-PA 1..165 1..165 831 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24332-PA 162 GL24332-PA 9..162 12..165 335 43.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18844-PA 162 GA18844-PA 9..162 12..165 337 43.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23662-PA 165 GM23662-PA 1..165 1..165 753 95.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18471-PA 165 GD18471-PA 1..165 1..165 753 95.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18938-PA 159 GK18938-PA 3..138 6..141 298 39.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24051-PA 165 GE24051-PA 1..165 1..165 699 87.3 Plus

IP08562.hyp Sequence

Translation from 127 to 624

> IP08562.hyp
MPPVEVSIRQGVAFLGLYVLLLAALVRPQMNFSIFVDSFFLQVNHSVVMV
LSYRFDSYMAMAAAPLSAVTVFALSKWNERCENPSSRKLVIMGVTCLYVL
VLVANVLANGIVVQQALIRFDQCPYRAWYMYSQMAMSFIKSSIAEVQEVF
TGRPQRRSRLIYRLH*

IP08562.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG5388-PB 165 CG5388-PB 1..165 1..165 831 100 Plus
CG5388-PA 165 CG5388-PA 1..165 1..165 831 100 Plus