IP08562.complete Sequence
651 bp (651 high quality bases) assembled on 2005-01-13
GenBank Submission: BT023038
> IP08562.complete
ATTTGTTAATATCAAAGTAAGTCTTCCAAATCTGAAGTTCGCAGTAGGTC
CTGGCAGTCAAAACTGAAATTGAATTGGATGTGGTTGTGACTCCGACCCT
CTGACGTCTTGCAGATATTAATTTGAAATGCCTCCTGTTGAAGTGAGCAT
ACGCCAAGGAGTTGCGTTTTTGGGCTTGTATGTGCTGCTCCTGGCTGCTT
TGGTGCGTCCCCAGATGAACTTCAGCATATTCGTGGACTCGTTCTTCCTG
CAGGTCAATCACTCGGTGGTAATGGTGCTGAGCTACCGGTTTGATTCCTA
TATGGCGATGGCCGCCGCACCACTCAGTGCCGTTACGGTGTTTGCCCTTT
CCAAGTGGAACGAACGTTGCGAGAATCCCTCCTCCAGGAAGCTAGTGATC
ATGGGCGTGACATGCTTGTATGTCTTGGTGCTGGTGGCCAATGTCCTGGC
CAATGGAATAGTGGTTCAGCAGGCGTTGATCCGCTTCGATCAATGTCCGT
ATCGGGCGTGGTATATGTACAGCCAGATGGCCATGTCCTTTATCAAATCC
TCGATTGCAGAAGTCCAGGAAGTTTTCACCGGACGGCCTCAACGTCGGTC
CCGACTTATATATCGTTTGCATTAGGTACAGCCAAAAAAAAAAAAAAAAA
A
IP08562.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:33:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5388-RA | 799 | CG5388-RA | 81..723 | 1..643 | 3215 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:57:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 18160708..18161224 | 633..117 | 2450 | 98.3 | Minus |
chr3R | 27901430 | chr3R | 18163755..18163870 | 116..1 | 580 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:57:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 22337104..22337630 | 643..117 | 2635 | 100 | Minus |
3R | 32079331 | 3R | 22340165..22340280 | 116..1 | 580 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:21:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 22077935..22078461 | 643..117 | 2635 | 100 | Minus |
3R | 31820162 | 3R | 22080996..22081111 | 116..1 | 580 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 19:57:20 has no hits.
IP08562.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:58:10 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 18160708..18161224 | 117..633 | 98 | <- | Minus |
chr3R | 18163755..18163870 | 1..116 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:15 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5388-RA | 1..498 | 128..625 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:52:50 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5388-RA | 1..498 | 128..625 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:01:10 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5388-RA | 1..498 | 128..625 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:37:28 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5388-RA | 1..498 | 128..625 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:26:52 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5388-RA | 1..498 | 128..625 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:35:12 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5388-RA | 23..647 | 1..625 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:52:50 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5388-RA | 28..660 | 1..633 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:01:10 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5388-RA | 28..660 | 1..633 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:37:28 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5388-RA | 23..647 | 1..625 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:26:52 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5388-RA | 28..660 | 1..633 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:10 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22337114..22337630 | 117..633 | 100 | <- | Minus |
3R | 22340165..22340280 | 1..116 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:10 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22337114..22337630 | 117..633 | 100 | <- | Minus |
3R | 22340165..22340280 | 1..116 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:10 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22337114..22337630 | 117..633 | 100 | <- | Minus |
3R | 22340165..22340280 | 1..116 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:01:10 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 18162836..18163352 | 117..633 | 100 | <- | Minus |
arm_3R | 18165887..18166002 | 1..116 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:12:07 Download gff for
IP08562.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22077945..22078461 | 117..633 | 100 | <- | Minus |
3R | 22080996..22081111 | 1..116 | 100 | | Minus |
IP08562.pep Sequence
Translation from 127 to 624
> IP08562.pep
MPPVEVSIRQGVAFLGLYVLLLAALVRPQMNFSIFVDSFFLQVNHSVVMV
LSYRFDSYMAMAAAPLSAVTVFALSKWNERCENPSSRKLVIMGVTCLYVL
VLVANVLANGIVVQQALIRFDQCPYRAWYMYSQMAMSFIKSSIAEVQEVF
TGRPQRRSRLIYRLH*
IP08562.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:39:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF19894-PA | 164 | GF19894-PA | 1..164 | 4..165 | 458 | 50 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:39:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG12528-PA | 165 | GG12528-PA | 1..165 | 1..165 | 668 | 90.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5388-PB | 165 | CG5388-PB | 1..165 | 1..165 | 831 | 100 | Plus |
CG5388-PA | 165 | CG5388-PA | 1..165 | 1..165 | 831 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:39:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24332-PA | 162 | GL24332-PA | 9..162 | 12..165 | 335 | 43.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:39:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA18844-PA | 162 | GA18844-PA | 9..162 | 12..165 | 337 | 43.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:39:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23662-PA | 165 | GM23662-PA | 1..165 | 1..165 | 753 | 95.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:39:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18471-PA | 165 | GD18471-PA | 1..165 | 1..165 | 753 | 95.2 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:39:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK18938-PA | 159 | GK18938-PA | 3..138 | 6..141 | 298 | 39.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:39:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE24051-PA | 165 | GE24051-PA | 1..165 | 1..165 | 699 | 87.3 | Plus |
IP08562.hyp Sequence
Translation from 127 to 624
> IP08562.hyp
MPPVEVSIRQGVAFLGLYVLLLAALVRPQMNFSIFVDSFFLQVNHSVVMV
LSYRFDSYMAMAAAPLSAVTVFALSKWNERCENPSSRKLVIMGVTCLYVL
VLVANVLANGIVVQQALIRFDQCPYRAWYMYSQMAMSFIKSSIAEVQEVF
TGRPQRRSRLIYRLH*
IP08562.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5388-PB | 165 | CG5388-PB | 1..165 | 1..165 | 831 | 100 | Plus |
CG5388-PA | 165 | CG5388-PA | 1..165 | 1..165 | 831 | 100 | Plus |