Clone IP08576 Report

Search the DGRC for IP08576

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:85
Well:76
Vector:pOT2
Associated Gene/TranscriptAANATL2-RA
Protein status:IP08576.pep: gold
Preliminary Size:651
Sequenced Size:864

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9486 2005-01-01 Successful iPCR screen
CG9486 2008-04-29 Release 5.5 accounting
CG9486 2008-08-15 Release 5.9 accounting
CG9486 2008-12-18 5.12 accounting

Clone Sequence Records

IP08576.complete Sequence

864 bp (864 high quality bases) assembled on 2005-01-13

GenBank Submission: BT023046

> IP08576.complete
CGAAGATGTCAGCGATCACCATACGCGCCATGACAATCGGGGATTACGAG
GAGGTCGAGGCCTTTCTCGCAGTGCACTTCTTCAAGCAGGAGCCGCTAAT
GCTGATCCCCCAGGAGGATCCCAAGCAGAGCGAGGTGTCTTCCGCGGAGG
CTGAGCTACACCGCTCGCTCATACCCCAGGATCTCTCCCTGGTGGCCGTC
GACGGGGAGCGCATTGTGGGCGTGGTTCTGGCCGGTGAATTGGTACCCGA
GGATCTGGAGAGGGAGTACCAGGAGGCTGAGCAGAAGGAGATCACGTGCC
TGCTGGACAAGATACACAAGTTTCTGGCCGGGATCGAGCGGCAGGCCAAT
ATCTTCAAGCACTACGGAGTGGAGCGGGCGCTTTACCTGTACATGCTCGG
TGTGGACGTGTCCATTCGACGCCAGAGAGTGGGCACCCGCCTGGTGGAGG
CCACCATTGAGCTGGGTCGCCAGCGTGGATTTCCCGTCGTCACATCTACC
TGCAGCAACCAGAACTCCAAACGCCTTATGACCGCCCTAAACATGGAGTG
CATACTCACAAAGGATTACGCGGACTACAAGGACGAGCACGGGGAGATCG
TCCTGCGGGCATCCGAGCCACACACCTCCGCCAGTGTCGTGGCCATACGA
CTGTAAGAGTAGGAAAATTACCAAAGAATGTAGAAACATAGCTCATGGCA
ACATGATAGATAGGCAATATAAGGAGGGGGAGTCGTAAGAAACTAAACCG
ATTTTGATAGATAAGAAAGCTTTGTTTATGTAGACATTGTAATCAACTTT
GTATTGTTTTCAGTTCAAGTATATAGGAATTCAAACTATTATCATAAAAA
AAAAAAAAAAAAAA

IP08576.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG9486-RA 845 CG9486-RA 1..845 1..845 4225 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6254921..6255765 1..845 4225 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6255871..6256717 1..847 4235 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6255871..6256717 1..847 4235 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:50:13 has no hits.

IP08576.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:51:20 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6254921..6255765 1..845 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:18 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
CG9486-RA 1..651 6..656 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:30 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
CG9486-RA 1..651 6..656 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:36:17 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
CG9486-RA 1..651 6..656 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:57:58 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
CG9486-RA 1..651 6..656 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:20:02 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
AANATL2-RA 1..651 6..656 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:09:49 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
CG9486-RA 1..651 6..656 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:30 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
CG9486-RA 13..857 1..845 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:36:17 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
CG9486-RA 13..857 1..845 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:57:58 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
CG9486-RA 1..651 6..656 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:02 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
AANATL2-RA 13..857 1..845 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:20 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6255871..6256715 1..845 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:20 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6255871..6256715 1..845 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:20 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6255871..6256715 1..845 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:36:17 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6255871..6256715 1..845 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:28 Download gff for IP08576.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6255871..6256715 1..845 100   Plus

IP08576.hyp Sequence

Translation from 2 to 655

> IP08576.hyp
KMSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEA
ELHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEQKEITCL
LDKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEA
TIELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIV
LRASEPHTSASVVAIRL*

IP08576.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
AANATL2-PB 216 CG9486-PB 1..216 2..217 1081 100 Plus
AANATL2-PA 216 CG9486-PA 1..216 2..217 1081 100 Plus
CG10659-PA 222 CG10659-PA 9..222 5..217 389 40.3 Plus
CG18607-PA 224 CG18607-PA 6..224 2..217 312 33.2 Plus
CG10476-PA 222 CG10476-PA 9..222 5..217 291 33.8 Plus

IP08576.pep Sequence

Translation from 2 to 655

> IP08576.pep
KMSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEA
ELHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEQKEITCL
LDKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEA
TIELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIV
LRASEPHTSASVVAIRL*

IP08576.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14512-PA 219 GF14512-PA 1..219 2..217 777 65.8 Plus
Dana\GF24634-PA 222 GF24634-PA 8..222 4..217 385 40.1 Plus
Dana\GF20033-PA 209 GF20033-PA 1..209 10..217 337 34.6 Plus
Dana\GF10714-PA 205 GF10714-PA 8..202 4..198 278 37.5 Plus
Dana\GF23038-PA 182 GF23038-PA 8..182 3..217 267 34.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10399-PA 216 GG10399-PA 1..216 2..217 1024 88.4 Plus
Dere\GG21595-PA 222 GG21595-PA 8..222 4..217 418 41.9 Plus
Dere\GG21596-PA 222 GG21596-PA 8..222 4..217 395 41 Plus
Dere\GG18468-PA 218 GG18468-PA 11..218 5..217 244 29.8 Plus
Dere\GG22946-PA 275 GG22946-PA 53..262 1..214 173 30.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11000-PA 211 GH11000-PA 7..211 16..217 443 44.4 Plus
Dgri\GH11001-PA 214 GH11001-PA 5..214 7..217 432 41.5 Plus
Dgri\GH10999-PA 223 GH10999-PA 10..223 4..217 382 38.4 Plus
Dgri\GH11002-PA 158 GH11002-PA 5..150 7..153 280 42.6 Plus
Dgri\GH12774-PA 217 GH12774-PA 10..217 5..217 264 31.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
AANATL2-PB 216 CG9486-PB 1..216 2..217 1081 100 Plus
AANATL2-PA 216 CG9486-PA 1..216 2..217 1081 100 Plus
AANATL3-PA 222 CG10659-PA 9..222 5..217 389 40.3 Plus
AANATL4-PA 224 CG18607-PA 6..224 2..217 312 33.2 Plus
AANATL5-PA 222 CG10476-PA 9..222 5..217 291 33.8 Plus
AANATL6-PB 222 CG18606-PB 9..222 5..217 287 33.3 Plus
AgmNAT-PA 216 CG15766-PA 9..216 5..217 239 29.1 Plus
AANAT1-PA 240 CG3318-PA 23..227 6..214 175 30.6 Plus
AANAT1-PB 275 CG3318-PB 58..262 6..214 175 30.6 Plus
AANATL7-PD 228 CG13759-PD 12..206 16..207 172 25.5 Plus
AANATL7-PC 228 CG13759-PC 12..206 16..207 172 25.5 Plus
AANATL7-PB 228 CG13759-PB 12..206 16..207 172 25.5 Plus
AANATL7-PA 228 CG13759-PA 12..206 16..207 172 25.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17519-PA 232 GI17519-PA 5..217 7..217 485 45.8 Plus
Dmoj\GI17520-PA 213 GI17520-PA 2..213 5..217 459 43.7 Plus
Dmoj\GI17517-PA 224 GI17517-PA 10..224 4..217 391 38.2 Plus
Dmoj\GI17518-PA 213 GI17518-PA 5..213 7..217 385 37.7 Plus
Dmoj\GI17524-PA 222 GI17524-PA 10..222 4..217 346 35.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25512-PA 221 GL25512-PA 6..221 5..217 713 63.4 Plus
Dper\GL26282-PA 225 GL26282-PA 8..225 4..217 369 37.2 Plus
Dper\GL11101-PA 224 GL11101-PA 10..224 4..217 367 38.1 Plus
Dper\GL26277-PA 196 GL26277-PA 8..176 4..174 314 40.4 Plus
Dper\GL15167-PA 215 GL15167-PA 7..215 5..217 261 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21823-PA 221 GA21823-PA 6..221 5..217 717 63.4 Plus
Dpse\GA28106-PA 219 GA28106-PA 8..219 4..217 412 41.1 Plus
Dpse\GA24612-PA 224 GA24612-PA 10..224 4..217 375 38.5 Plus
Dpse\GA28109-PA 225 GA28109-PA 8..225 4..217 374 38 Plus
Dpse\GA13941-PA 215 GA13941-PA 7..215 5..217 261 33.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18616-PA 216 GM18616-PA 1..216 2..217 1094 95.4 Plus
Dsec\GM21944-PA 224 GM21944-PA 6..224 2..217 327 34.1 Plus
Dsec\GM19842-PA 211 GM19842-PA 8..211 4..217 253 31.3 Plus
Dsec\GM12613-PA 216 GM12613-PA 9..216 5..217 243 30.7 Plus
Dsec\GM13165-PA 137 GM13165-PA 3..137 82..217 199 34.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23397-PA 216 GD23397-PA 1..216 2..217 1097 96.3 Plus
Dsim\GD21720-PA 222 GD21720-PA 8..222 4..217 397 39.6 Plus
Dsim\GD11441-PA 224 GD11441-PA 6..224 2..217 325 32.3 Plus
Dsim\GD11440-PA 222 GD11440-PA 8..222 4..217 281 32.7 Plus
Dsim\GD25332-PA 222 GD25332-PA 8..222 4..217 258 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15344-PA 215 GJ15344-PA 1..215 2..217 499 45 Plus
Dvir\GJ15334-PA 232 GJ15334-PA 5..217 7..217 475 45.3 Plus
Dvir\GJ18418-PA 224 GJ18418-PA 9..224 3..217 432 41.7 Plus
Dvir\GJ15312-PA 224 GJ15312-PA 9..224 3..217 430 41.7 Plus
Dvir\GJ15301-PA 221 GJ15301-PA 10..221 4..217 403 40.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14749-PA 226 GK14749-PA 17..226 8..217 614 54.9 Plus
Dwil\GK15374-PA 209 GK15374-PA 1..209 10..217 398 39.8 Plus
Dwil\GK15376-PA 223 GK15376-PA 8..223 4..217 384 37.2 Plus
Dwil\GK15375-PA 223 GK15375-PA 8..223 4..217 382 36.7 Plus
Dwil\GK15377-PA 223 GK15377-PA 8..223 4..217 381 36.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13747-PA 216 GE13747-PA 1..216 2..217 1024 88.9 Plus
Dyak\GE12614-PA 222 GE12614-PA 8..222 4..217 414 41.5 Plus
Dyak\GE12035-PA 219 GE12035-PA 1..219 2..217 349 35.3 Plus
Dyak\GE12032-PA 222 GE12032-PA 7..222 3..217 251 30.3 Plus
Dyak\GE16784-PA 235 GE16784-PA 9..235 5..217 220 27.4 Plus