BDGP Sequence Production Resources |
Search the DGRC for IP08601
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 86 |
Well: | 1 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32061-RA |
Protein status: | IP08601.pep: gold |
Preliminary Size: | 645 |
Sequenced Size: | 838 |
Gene | Date | Evidence |
---|---|---|
CG32061 | 2005-01-01 | Successful iPCR screen |
CG32061 | 2008-04-29 | Release 5.5 accounting |
CG32061 | 2008-08-15 | Release 5.9 accounting |
CG32061 | 2008-12-18 | 5.12 accounting |
838 bp (838 high quality bases) assembled on 2005-01-13
GenBank Submission: BT023050
> IP08601.complete AGCACATTGAGGTCACACAAAATTAGATACAAAATTTAAAAAACGACTTA AAATTTTTTCATTTTGAACTCCAAATTCGAGAACCATGTTCATACCCAAA ATACGAGACATTGGTTACTTTGCGCTGCTGACATCCCTGCACTTGGGCTC AAATCTTCAGCCGGTCATCGAGGCGAATGCCAATCTAAAAACGGTCTATC CCTCCGTGAATCGTAATCTAACGCTTCAATTGGGCTATAAATACAATCAC TGGATGCTGGTTAAGGCCATAATGTATTCACTACTATCTATGATCGGAGT TTGGTACTCACGACACTTGCAAAGTGGCAAAAGTGAGGTATCGATGGAAA AGAAAGGAATCCTTAAAACTACGACAACAGCTGCAGAGCAAGTGAAAAAC AATTGGATCAAAAAACAGAATTCCGCATTGAAAAACGGAACCCTGCCGCG GAATATATTCCTGTTATTTGCTTTGCCCTGGATATTGACCTTTGTGGCCA GCGGATTGATCAACTATATTCGATTTTACATGGTCATACAGCATTTTTGC ATATCTAACTGGAGGGCGATTCAGCTTTATGGAGAACTGCAAGGCCTCTT TTGGCATCGTTCTACATCCGTGACTTTAATACCCTATTGGTCGCAAATTA TCGGCGGAGGAGTATCCTTGGAGAAGGCATCTCATCTTTCTGGAAATTGT ATTTCCATTGAAACACATCTTTTGGACTGAACATGGCAATCTATATTTAA AATTTTTATTTTATGTTTGATGCAAAAATTATAATAATGGAAAATAAATC GATTTTGTTGACTTAGCTCTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32061-RA | 820 | CG32061-RA | 1..820 | 1..820 | 4100 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 10455245..10456064 | 1..820 | 3965 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 10463816..10464638 | 1..823 | 4115 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 10456916..10457738 | 1..823 | 4115 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 10455245..10456064 | 1..820 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32061-RA | 1..645 | 86..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32061-RA | 1..645 | 86..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32061-RA | 1..645 | 86..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32061-RA | 1..645 | 86..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32061-RA | 1..645 | 86..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32061-RA | 1..645 | 86..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32061-RA | 1..820 | 1..820 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32061-RA | 1..820 | 1..820 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32061-RA | 1..645 | 86..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32061-RA | 1..820 | 1..820 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10463816..10464635 | 1..820 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10463816..10464635 | 1..820 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10463816..10464635 | 1..820 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 10456916..10457735 | 1..820 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10456916..10457735 | 1..820 | 100 | Plus |
Translation from 85 to 729
> IP08601.pep MFIPKIRDIGYFALLTSLHLGSNLQPVIEANANLKTVYPSVNRNLTLQLG YKYNHWMLVKAIMYSLLSMIGVWYSRHLQSGKSEVSMEKKGILKTTTTAA EQVKNNWIKKQNSALKNGTLPRNIFLLFALPWILTFVASGLINYIRFYMV IQHFCISNWRAIQLYGELQGLFWHRSTSVTLIPYWSQIIGGGVSLEKASH LSGNCISIETHLLD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10594-PA | 211 | GF10594-PA | 1..211 | 1..214 | 667 | 58.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15434-PA | 211 | GG15434-PA | 1..211 | 1..214 | 936 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14944-PA | 206 | GH14944-PA | 2..171 | 3..175 | 221 | 33.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32061-PA | 214 | CG32061-PA | 1..214 | 1..214 | 1121 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11470-PA | 155 | GI11470-PA | 1..151 | 63..213 | 160 | 31.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21141-PA | 234 | GL21141-PA | 3..231 | 5..213 | 393 | 36.4 | Plus |
Dper\GL15461-PA | 197 | GL15461-PA | 3..194 | 18..213 | 344 | 37.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA29084-PA | 234 | GA29084-PA | 3..231 | 5..213 | 383 | 36 | Plus |
Dpse\GA23826-PA | 226 | GA23826-PA | 3..223 | 18..213 | 328 | 34.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25210-PA | 215 | GM25210-PA | 1..215 | 1..214 | 1040 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14242-PA | 215 | GD14242-PA | 1..215 | 1..214 | 1057 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13662-PA | 214 | GJ13662-PA | 2..210 | 3..213 | 247 | 32.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19106-PA | 211 | GK19106-PA | 5..211 | 5..214 | 147 | 25.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21745-PA | 211 | GE21745-PA | 1..211 | 1..214 | 927 | 83.2 | Plus |
Translation from 85 to 729
> IP08601.hyp MFIPKIRDIGYFALLTSLHLGSNLQPVIEANANLKTVYPSVNRNLTLQLG YKYNHWMLVKAIMYSLLSMIGVWYSRHLQSGKSEVSMEKKGILKTTTTAA EQVKNNWIKKQNSALKNGTLPRNIFLLFALPWILTFVASGLINYIRFYMV IQHFCISNWRAIQLYGELQGLFWHRSTSVTLIPYWSQIIGGGVSLEKASH LSGNCISIETHLLD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32061-PA | 214 | CG32061-PA | 1..214 | 1..214 | 1121 | 100 | Plus |