Clone IP08601 Report

Search the DGRC for IP08601

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:86
Well:1
Vector:pOT2
Associated Gene/TranscriptCG32061-RA
Protein status:IP08601.pep: gold
Preliminary Size:645
Sequenced Size:838

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32061 2005-01-01 Successful iPCR screen
CG32061 2008-04-29 Release 5.5 accounting
CG32061 2008-08-15 Release 5.9 accounting
CG32061 2008-12-18 5.12 accounting

Clone Sequence Records

IP08601.complete Sequence

838 bp (838 high quality bases) assembled on 2005-01-13

GenBank Submission: BT023050

> IP08601.complete
AGCACATTGAGGTCACACAAAATTAGATACAAAATTTAAAAAACGACTTA
AAATTTTTTCATTTTGAACTCCAAATTCGAGAACCATGTTCATACCCAAA
ATACGAGACATTGGTTACTTTGCGCTGCTGACATCCCTGCACTTGGGCTC
AAATCTTCAGCCGGTCATCGAGGCGAATGCCAATCTAAAAACGGTCTATC
CCTCCGTGAATCGTAATCTAACGCTTCAATTGGGCTATAAATACAATCAC
TGGATGCTGGTTAAGGCCATAATGTATTCACTACTATCTATGATCGGAGT
TTGGTACTCACGACACTTGCAAAGTGGCAAAAGTGAGGTATCGATGGAAA
AGAAAGGAATCCTTAAAACTACGACAACAGCTGCAGAGCAAGTGAAAAAC
AATTGGATCAAAAAACAGAATTCCGCATTGAAAAACGGAACCCTGCCGCG
GAATATATTCCTGTTATTTGCTTTGCCCTGGATATTGACCTTTGTGGCCA
GCGGATTGATCAACTATATTCGATTTTACATGGTCATACAGCATTTTTGC
ATATCTAACTGGAGGGCGATTCAGCTTTATGGAGAACTGCAAGGCCTCTT
TTGGCATCGTTCTACATCCGTGACTTTAATACCCTATTGGTCGCAAATTA
TCGGCGGAGGAGTATCCTTGGAGAAGGCATCTCATCTTTCTGGAAATTGT
ATTTCCATTGAAACACATCTTTTGGACTGAACATGGCAATCTATATTTAA
AATTTTTATTTTATGTTTGATGCAAAAATTATAATAATGGAAAATAAATC
GATTTTGTTGACTTAGCTCTAAAAAAAAAAAAAAAAAA

IP08601.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG32061-RA 820 CG32061-RA 1..820 1..820 4100 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10455245..10456064 1..820 3965 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10463816..10464638 1..823 4115 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10456916..10457738 1..823 4115 100 Plus
Blast to na_te.dros performed 2019-03-15 12:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 5707..5819 9..121 114 60.3 Plus
transib3 2883 transib3 TRANSIB3 2883bp 1557..1643 121..31 112 67.4 Minus

IP08601.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:34:51 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10455245..10456064 1..820 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:20 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
CG32061-RA 1..645 86..730 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:33:38 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
CG32061-RA 1..645 86..730 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:47 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
CG32061-RA 1..645 86..730 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:01:14 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
CG32061-RA 1..645 86..730 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:03:53 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
CG32061-RA 1..645 86..730 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:12:48 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
CG32061-RA 1..645 86..730 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:33:38 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
CG32061-RA 1..820 1..820 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:47 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
CG32061-RA 1..820 1..820 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:01:14 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
CG32061-RA 1..645 86..730 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:03:53 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
CG32061-RA 1..820 1..820 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:51 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10463816..10464635 1..820 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:51 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10463816..10464635 1..820 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:51 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10463816..10464635 1..820 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:47 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10456916..10457735 1..820 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:38:03 Download gff for IP08601.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10456916..10457735 1..820 100   Plus

IP08601.pep Sequence

Translation from 85 to 729

> IP08601.pep
MFIPKIRDIGYFALLTSLHLGSNLQPVIEANANLKTVYPSVNRNLTLQLG
YKYNHWMLVKAIMYSLLSMIGVWYSRHLQSGKSEVSMEKKGILKTTTTAA
EQVKNNWIKKQNSALKNGTLPRNIFLLFALPWILTFVASGLINYIRFYMV
IQHFCISNWRAIQLYGELQGLFWHRSTSVTLIPYWSQIIGGGVSLEKASH
LSGNCISIETHLLD*

IP08601.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10594-PA 211 GF10594-PA 1..211 1..214 667 58.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15434-PA 211 GG15434-PA 1..211 1..214 936 85 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14944-PA 206 GH14944-PA 2..171 3..175 221 33.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32061-PA 214 CG32061-PA 1..214 1..214 1121 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11470-PA 155 GI11470-PA 1..151 63..213 160 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21141-PA 234 GL21141-PA 3..231 5..213 393 36.4 Plus
Dper\GL15461-PA 197 GL15461-PA 3..194 18..213 344 37.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29084-PA 234 GA29084-PA 3..231 5..213 383 36 Plus
Dpse\GA23826-PA 226 GA23826-PA 3..223 18..213 328 34.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25210-PA 215 GM25210-PA 1..215 1..214 1040 92.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14242-PA 215 GD14242-PA 1..215 1..214 1057 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13662-PA 214 GJ13662-PA 2..210 3..213 247 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19106-PA 211 GK19106-PA 5..211 5..214 147 25.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21745-PA 211 GE21745-PA 1..211 1..214 927 83.2 Plus

IP08601.hyp Sequence

Translation from 85 to 729

> IP08601.hyp
MFIPKIRDIGYFALLTSLHLGSNLQPVIEANANLKTVYPSVNRNLTLQLG
YKYNHWMLVKAIMYSLLSMIGVWYSRHLQSGKSEVSMEKKGILKTTTTAA
EQVKNNWIKKQNSALKNGTLPRNIFLLFALPWILTFVASGLINYIRFYMV
IQHFCISNWRAIQLYGELQGLFWHRSTSVTLIPYWSQIIGGGVSLEKASH
LSGNCISIETHLLD*

IP08601.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG32061-PA 214 CG32061-PA 1..214 1..214 1121 100 Plus