IP08644.complete Sequence
690 bp (690 high quality bases) assembled on 2005-03-06
GenBank Submission: BT023078
> IP08644.complete
TTTCACTTGTAACTCAGTTGATAAGCAGAAGCTGCAGCAAAAACTATGTT
GGCGGATAGTGCAACTTTGACTTTAGCTATCTTTGTAGGTACGTCTGTTG
TGCTTGTTTCGGTTTCATCTTCAAGTTTGTCGGAAATTAAGCCGATGAAC
AACGGACATATCGTGACGCCTTTGGGATGCCATCGTCGTGTATACACGTA
TAAAGTGACACAGTCCGATCTTCAAGGACACGAGTGTTGGGACTATGTAA
GCGTTTGGTCGTGTTGGGGACGATGCGACTCAAGCGAAATTTCCGATTGG
AAGTTTCCTTACAAGCGTTCGTTCCATCCTGTTTGTGTCCACGCCCAGCG
GCAGCTGGTAGTAGCTATCCTAAAGAATTGTCACCCTAAAGCAGAGGACA
GCGTAAGCAAGTACCAGTACATGGAGGCAGTGAACTGTCACTGCCAGACG
TGCTCCACACAGGATACCAGCTGCGAAGCTCCGGCCAATAATGAAATGGC
TGGGGGCAGCAGGGCAATCATGGTAGGCGCCGATACCAAAAACTTGGACT
ATTAGCGAGTTTGGAAATTGGGTTCCTAACTAAATTGCGTGGGGGAATGT
GATGGCTTTATCTACAACAGCAAGTTAATGCAAAAATGCTTAGTATAAAA
TGCAATAAAACAAAATAAAATTAAAAAAAAAAAAAAAAAA
IP08644.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:48:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Gpb5-RA | 891 | Gpb5-RA | 220..891 | 1..672 | 3360 | 100 | Plus |
Gpb5.a | 678 | Gpb5.a | 102..678 | 77..653 | 2885 | 100 | Plus |
Gpb5-RC | 557 | Gpb5-RC | 47..557 | 69..579 | 2555 | 100 | Plus |
Gpb5.a | 678 | Gpb5.a | 34..101 | 1..68 | 340 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:13:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2LHet | 368865 | chr2LHet | 167407..168010 | 69..672 | 3020 | 100 | Plus |
chr2LHet | 368865 | chr2LHet | 167279..167347 | 1..69 | 345 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:13:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 23311861..23312468 | 69..676 | 3040 | 100 | Plus |
2L | 23513712 | 2L | 23311733..23311801 | 1..69 | 345 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 23311861..23312468 | 69..676 | 3040 | 100 | Plus |
2L | 23513712 | 2L | 23311733..23311801 | 1..69 | 345 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 10:13:12 has no hits.
IP08644.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:14:13 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2LHet | 167279..167346 | 1..68 | 100 | -> | Plus |
chr2LHet | 167407..168010 | 69..672 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:29 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Gpb5-RA | 1..510 | 46..555 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:18:15 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Gpb5-RA | 1..510 | 46..555 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:57:38 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Gpb5-RA | 1..510 | 46..555 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:31 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Gpb5-RA | 1..510 | 46..555 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:00:27 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Gpb5-RA | 1..510 | 46..555 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:18:05 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Gpb5-RA | 1..672 | 1..672 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:18:15 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Gpb5-RA | 1..672 | 1..672 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:57:38 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Gpb5-RA | 1..657 | 16..672 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:31 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Gpb5-RA | 1..672 | 1..672 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:00:27 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Gpb5-RA | 1..657 | 16..672 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:13 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 23311733..23311800 | 1..68 | 100 | -> | Plus |
2L | 23311861..23312464 | 69..672 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:13 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 23311733..23311800 | 1..68 | 100 | -> | Plus |
2L | 23311861..23312464 | 69..672 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:13 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 23311733..23311800 | 1..68 | 100 | -> | Plus |
2L | 23311861..23312464 | 69..672 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:57:38 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2LHet | 167248..167315 | 1..68 | 100 | -> | Plus |
2LHet | 167376..167979 | 69..672 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:38:23 Download gff for
IP08644.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 23311861..23312464 | 69..672 | 100 | | Plus |
2L | 23311733..23311800 | 1..68 | 100 | -> | Plus |
IP08644.pep Sequence
Translation from 45 to 554
> IP08644.pep
MLADSATLTLAIFVGTSVVLVSVSSSSLSEIKPMNNGHIVTPLGCHRRVY
TYKVTQSDLQGHECWDYVSVWSCWGRCDSSEISDWKFPYKRSFHPVCVHA
QRQLVVAILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDTSCEAPANNE
MAGGSRAIMVGADTKNLDY*
IP08644.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Gpb5-PA | 169 | CG40041-PA | 1..169 | 1..169 | 918 | 100 | Plus |
Gpb5-PC | 169 | CG40041-PC | 9..169 | 9..169 | 882 | 100 | Plus |
Gpb5-PD | 136 | CG40041-PD | 1..136 | 34..169 | 771 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:27:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI17479-PA | 167 | GI17479-PA | 3..167 | 6..169 | 596 | 64.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:27:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA30008-PA | 170 | GA30008-PA | 1..170 | 2..169 | 660 | 70.9 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:27:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ14991-PA | 167 | GJ14991-PA | 3..167 | 6..169 | 580 | 63.7 | Plus |
IP08644.hyp Sequence
Translation from 45 to 554
> IP08644.hyp
MLADSATLTLAIFVGTSVVLVSVSSSSLSEIKPMNNGHIVTPLGCHRRVY
TYKVTQSDLQGHECWDYVSVWSCWGRCDSSEISDWKFPYKRSFHPVCVHA
QRQLVVAILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDTSCEAPANNE
MAGGSRAIMVGADTKNLDY*
IP08644.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:55:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Gpb5-PA | 169 | CG40041-PA | 1..169 | 1..169 | 918 | 100 | Plus |
Gpb5-PC | 169 | CG40041-PC | 9..169 | 9..169 | 882 | 100 | Plus |
Gpb5-PD | 136 | CG40041-PD | 1..136 | 34..169 | 771 | 100 | Plus |