Clone IP08717 Report

Gene	Date	Evidence
CG32391	2005-01-01	Successful iPCR screen
CG32391	2008-04-29	Release 5.5 accounting
CG32391	2008-08-15	Release 5.9 accounting
CG32391	2008-12-18	5.12 accounting

Clone Sequence Records

IP08717.complete Sequence

760 bp (760 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023106

> IP08717.complete
CAGATATAACCATCTGGCCGTTTTTCCACTCGGAATCTGTGGATGATAGG
CGAAGATATATCATAAAGGTTATTCTGGAGTTATGCGTCTTCATTGTGAT
AGGATTTGTTCACTGGATCCTGGTGCTAACCTTGCTGCACGAATGGTTTC
TGGTCTTGGTAAACGAGCACTCATCTGCATTGCTCCTAGCCTTTGTATTT
GGCATTTTCCTACTTTTCCTGTTTGCCCTAAGTATGCCGCTAAGGAAAAT
GTCCTGTGTCAACTGGCTGATTACGTTTATTATCTTTCTCTCAGTGTGCT
GATCATATCATCGGGAGTACTTTATATGCTTGCCGGATTTCTGATTGTCA
GCCTTGCATTTGTGTTATGTACACTTATAGCTGCTTTAATGGCGTATGAC
CTCACAGGCACCGGACTCTACCTATATGCCCTTGCAACTGGCACTTACTC
ACTGAGCATATACTCCCTGGTATTGTATGTGGTTCTCGACGTGATCTGGG
GATTTTATCTCTTCGCATTCTGTATCGGCTGTGTGGTGATGATGTTCCTG
ATGTATCATGTGCAGTGCATCATGGGCGGAAGAAGGGCCTCGACCAAGTT
GTTCGATGACAAGTTCGCCGCCCTGCTGCTGTTCCACGAGTTCATAGGCC
TCTTTGTGCTAACCCTCTACTGGCGGCCCATAATGCATCGCCTGCAGTTG
AAACAATAAACGAACAATCGGTTTTAAGTAATCCCCCTGTAAAAAAAAAA
AAAAAAAAAA

IP08717.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:00

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
CG32391.a	1102	CG32391.a	363..1102	1..740	3700	100	Plus
CG32391-RB	748	CG32391-RB	9..748	1..740	3700	100	Plus
CG32391-RA	907	CG32391-RA	574..907	407..740	1670	100	Plus
CG32391-RA	907	CG32391-RA	165..448	1..284	1420	100	Plus
CG32391-RA	907	CG32391-RA	465..574	285..394	550	100	Plus

Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:44:30

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
chr3L	24539361	chr3L	7060431..7060627	740..544	955	99	Minus
chr3L	24539361	chr3L	7060691..7060841	544..394	755	100	Minus
chr3L	24539361	chr3L	7061074..7061218	284..140	695	98.6	Minus
chr3L	24539361	chr3L	7061271..7061409	139..1	695	100	Minus
chr3L	24539361	chr3L	7060894..7061003	394..285	535	99.1	Minus

Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:56:54 has no hits.

Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:44:27

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
3L	28110227	3L	7068210..7068407	741..544	990	100	Minus
3L	28110227	3L	7068471..7068621	544..394	755	100	Minus
3L	28110227	3L	7068854..7068998	284..140	725	100	Minus
3L	28110227	3L	7069051..7069189	139..1	695	100	Minus
3L	28110227	3L	7068674..7068783	394..285	550	100	Minus

Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:34

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
3L	28103327	3L	7061310..7061507	741..544	990	100	Minus
3L	28103327	3L	7061571..7061721	544..394	755	100	Minus
3L	28103327	3L	7061954..7062098	284..140	725	100	Minus
3L	28103327	3L	7062151..7062289	139..1	695	100	Minus
3L	28103327	3L	7061774..7061883	394..285	550	100	Minus

Blast to na_te.dros performed on 2019-03-15 15:44:28 has no hits.

IP08717.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:45:14 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
chr3L	7060691..7060840	395..544	100	<-	Minus
chr3L	7060894..7061003	285..394	99	<-	Minus
chr3L	7061074..7061218	140..284	98	<-	Minus
chr3L	7061271..7061409	1..139	100		Minus
chr3L	7060431..7060626	545..740	98	<-	Minus

Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:38 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32391-RA	1..202	83..284	100	->	Plus
CG32391-RA	219..630	285..709	96		Plus

Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:18:02 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32391-RB	1..627	83..709	100		Plus

Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:38:23 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32391-RB	1..627	83..709	100		Plus

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:20 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32391-RA	1..202	83..284	100	->	Plus
CG32391-RA	219..630	285..709	96		Plus

Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:14:15 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32391-RB	1..627	83..709	100		Plus

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:17:47 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32391-RA	309..720	285..709	96		Plus
CG32391-RA	9..292	1..284	100	->	Plus

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:18:02 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32391-RB	9..748	1..740	100		Plus

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:38:23 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32391-RB	9..748	1..740	100		Plus

Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:20 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32391-RA	9..292	1..284	100	->	Plus
CG32391-RA	309..720	285..709	96		Plus

Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:14:15 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG32391-RB	9..748	1..740	100		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:14 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	7069051..7069189	1..139	100		Minus
3L	7068211..7068406	545..740	100	<-	Minus
3L	7068471..7068620	395..544	100	<-	Minus
3L	7068674..7068783	285..394	100	<-	Minus
3L	7068854..7068998	140..284	100	<-	Minus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:14 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	7069051..7069189	1..139	100		Minus
3L	7068211..7068406	545..740	100	<-	Minus
3L	7068471..7068620	395..544	100	<-	Minus
3L	7068674..7068783	285..394	100	<-	Minus
3L	7068854..7068998	140..284	100	<-	Minus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:14 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	7069051..7069189	1..139	100		Minus
3L	7068211..7068406	545..740	100	<-	Minus
3L	7068471..7068620	395..544	100	<-	Minus
3L	7068674..7068783	285..394	100	<-	Minus
3L	7068854..7068998	140..284	100	<-	Minus

Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:38:23 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
arm_3L	7062151..7062289	1..139	100		Minus
arm_3L	7061311..7061506	545..740	100	<-	Minus
arm_3L	7061571..7061720	395..544	100	<-	Minus
arm_3L	7061774..7061883	285..394	100	<-	Minus
arm_3L	7061954..7062098	140..284	100	<-	Minus

Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:38:10 Download gff for IP08717.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	7061311..7061506	545..740	100	<-	Minus
3L	7061571..7061720	395..544	100	<-	Minus
3L	7061774..7061883	285..394	100	<-	Minus
3L	7061954..7062098	140..284	100	<-	Minus
3L	7062151..7062289	1..139	100		Minus

IP08717.pep Sequence

Translation from 82 to 708

> IP08717.pep
MRLHCDRICSLDPGANLAARMVSGLGKRALICIAPSLCIWHFPTFPVCPK
YAAKENVLCQLADYVYYLSLSVLIISSGVLYMLAGFLIVSLAFVLCTLIA
ALMAYDLTGTGLYLYALATGTYSLSIYSLVLYVVLDVIWGFYLFAFCIGC
VVMMFLMYHVQCIMGGRRASTKLFDDKFAALLLFHEFIGLFVLTLYWRPI
MHRLQLKQ*

IP08717.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:26:00

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dana\GF24797-PA	248	GF24797-PA	108..248	68..208	391	58.2	Plus
Dana\GF12132-PA	314	GF12132-PA	116..231	86..203	182	37.3	Plus

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:26:01

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dere\GG15005-PA	262	GG15005-PA	122..262	68..208	645	91.5	Plus
Dere\GG25223-PA	290	GG25223-PA	129..235	100..207	158	32.4	Plus

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:06

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
CG32391-PC	244	CG32391-PC	104..244	68..208	715	99.3	Plus
CG12209-PA	285	CG12209-PA	111..225	82..196	196	32.2	Plus
CG34315-PB	266	CG34315-PB	97..228	68..199	163	31.1	Plus
CG42571-PB	292	CG42571-PB	91..224	69..198	145	29.9	Plus

Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:26:02

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dper\GL25150-PA	169	GL25150-PA	23..151	70..198	334	53.5	Plus
Dper\GL20108-PA	264	GL20108-PA	111..225	82..196	183	35.7	Plus
Dper\GL10484-PA	281	GL10484-PA	127..225	98..196	143	35.4	Plus

Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:26:03

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dpse\GA23699-PA	251	GA23699-PA	105..236	70..201	345	53.8	Plus
Dpse\GA24933-PA	264	GA24933-PA	111..225	82..196	186	36.5	Plus
Dpse\GA24384-PA	281	GA24384-PA	127..225	98..196	143	35.4	Plus

Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:26:04

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsec\GM13794-PA	209	GM13794-PA	1..209	1..208	820	80	Plus
Dsec\GM20542-PA	285	GM20542-PA	129..225	100..196	161	34	Plus

Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:26:04

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsim\GD13093-PA	209	GD13093-PA	1..209	1..208	797	78.1	Plus
Dsim\GD25999-PA	285	GD25999-PA	129..225	100..196	161	34	Plus

Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:26:05

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dvir\GJ12240-PA	89	GJ12240-PA	14..87	126..199	192	48.6	Plus
Dvir\GJ11362-PA	903	GJ11362-PA	86..235	57..203	151	27.8	Plus

Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:26:05

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dwil\GK17543-PA	158	GK17543-PA	62..158	102..198	216	44.3	Plus
Dwil\GK18017-PA	279	GK18017-PA	130..225	101..196	149	34.4	Plus

Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:26:06

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dyak\GE20448-PA	336	GE20448-PA	236..336	108..208	505	96	Plus
Dyak\GE21688-PA	286	GE21688-PA	129..235	100..207	162	33.3	Plus

IP08717.hyp Sequence

Translation from 82 to 708

> IP08717.hyp
MRLHCDRICSLDPGANLAARMVSGLGKRALICIAPSLCIWHFPTFPVCPK
YAAKENVLCQLADYVYYLSLSVLIISSGVLYMLAGFLIVSLAFVLCTLIA
ALMAYDLTGTGLYLYALATGTYSLSIYSLVLYVVLDVIWGFYLFAFCIGC
VVMMFLMYHVQCIMGGRRASTKLFDDKFAALLLFHEFIGLFVLTLYWRPI
MHRLQLKQ*

IP08717.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:56:20

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
CG32391-PB	208	CG32391-PB	1..208	1..208	1090	100	Plus
CG32391-PA	209	CG32391-PA	1..209	1..208	871	80	Plus
CG12209-PA	285	CG12209-PA	111..225	82..196	196	32.2	Plus
CG34315-PB	266	CG34315-PB	97..228	68..199	163	31.1	Plus
CG42571-PB	292	CG42571-PB	91..224	69..198	145	29.9	Plus

Library:	IP
Tissue Source:	Pooled D melanogaster cDNA libraries
Created by:
Date Registered:	2004-07-08
Comments:
Original Plate Number:	87
Well:	17
Vector:	pOT2
Associated Gene/Transcript	CG32391-RB
Protein status:	IP08717.pep: gold
Preliminary Size:	720
Sequenced Size:	760

Clone IP08717 Report

Clone and Library Details

Associated Genes

Clone Sequence Records

IP08717.complete Sequence

IP08717.complete Blast Records

IP08717.complete Sim4 Records

IP08717.pep Sequence

IP08717.pep Blast Records

IP08717.hyp Sequence

IP08717.hyp Blast Records