Clone IP08740 Report

Search the DGRC for IP08740

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:87
Well:40
Vector:pOT2
Associated Gene/TranscriptCG3526-RC
Protein status:IP08740.pep: gold
Preliminary Size:885
Sequenced Size:879

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3526 2005-01-01 Successful iPCR screen
CG3526 2008-04-29 Release 5.5 accounting
CG3526 2008-08-15 Release 5.9 accounting
CG3526 2008-12-18 5.12 accounting

Clone Sequence Records

IP08740.complete Sequence

879 bp (879 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023118

> IP08740.complete
TCCAAGGACGGACTCCACTTCTTGCTCCGGGCACTCCTATCCACCTGTCC
ACCTGATCCCGATTCGGTTGCCGGTCCTGTTCCCAACGCTCACCTAAGCC
GCTTTGTGCACGCATGAGTGGTTCGCCATCGATGCCCCGTCGCCGCCAGA
TCGGGCATACTTCCGGCCATTGTAATGTGCGCTGCGATGGCTGCGGCAAC
AATAGGATGACCTTCTATCGCTACAAGTGCCTGCACTGCCTGGACTATGA
TCTTTGCTCCGACTGCAAGGAAAATGGGGTCTCAAACGGGTTGCACAGTC
TGGATCATCCGCTCCAGTGCCTAATGGATCGTGATGCACTTGAGCTGCAC
TTCGCCGGTGAGCCGATTCCGATATTGTGCGCCGACAGCTTCACGTGCCC
AGTGTGCGGTGAAATGGGCTTTTCCGTAGAGGATCTGAGGACGCACTGCC
AAGATAATCATCGCATGGCGCGCACAGTTTGCATTTGCCCAGTCTGCGCG
GCGGTCCCATTGTCGCAACCGAGTCACATTGCTCACATTGCCAATCACTT
GATGTTCTCGCCATCGCATCGCGCTACAGGGGATCCGATGATCGATATCA
GCGCCACTTCCCAGGCTGAGGGCTCCAGTTTGCCCCAGAACTCTGCCGTG
AGCTCTGGATCTGGCGCTCAACACACTTTTTCCAGCTCGGAAAATTCCCA
GGTGCGCTTCCTTCTACCCGGAAACAGAGCTCCCTTAGCTGATTCCGACG
ATTTTAACATGGACAATTGGGAGGTATAAAACCCTTCGCATCAGGATGAC
GAAGGAGCACTACACAACATTATAGGTTTGAAGATTTTTACCCCACATCA
GAAACTACACAAAAAAAAAAAAAAAAAAA

IP08740.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG3526-RC 1312 CG3526-RC 189..1059 1..871 4340 99.8 Plus
CG3526-RA 1155 CG3526-RA 108..864 115..871 3770 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2786957..2787701 116..860 3725 100 Plus
chrX 22417052 chrX 2784500..2784615 1..116 580 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:57:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2893220..2893975 116..871 3765 99.9 Plus
X 23542271 X 2890768..2890883 1..116 580 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2901318..2902073 116..871 3765 99.8 Plus
X 23527363 X 2898866..2898981 1..116 580 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:15:23 has no hits.

IP08740.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:16:09 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2784500..2784615 1..116 100 -> Plus
chrX 2786958..2787699 117..860 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:43 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
CG3526-RC 1..666 114..779 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:18:06 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
CG3526-RC 1..666 114..779 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:36 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
CG3526-RC 1..666 114..779 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:23 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
CG3526-RC 1..666 114..779 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:24:18 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
CG3526-RC 1..666 114..779 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:17:52 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
CG3526-RC 1..860 1..860 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:18:06 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
CG3526-RC 1..860 1..860 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:36 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
CG3526-RC 1..860 1..860 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:23 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
CG3526-RC 1..860 1..860 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:24:18 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
CG3526-RC 1..860 1..860 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:09 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
X 2890768..2890883 1..116 100 -> Plus
X 2893221..2893964 117..860 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:09 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
X 2890768..2890883 1..116 100 -> Plus
X 2893221..2893964 117..860 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:09 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
X 2890768..2890883 1..116 100 -> Plus
X 2893221..2893964 117..860 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:36 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2784801..2784916 1..116 100 -> Plus
arm_X 2787254..2787997 117..860 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:38:14 Download gff for IP08740.complete
Subject Subject Range Query Range Percent Splice Strand
X 2901319..2902062 117..860 100   Plus
X 2898866..2898981 1..116 100 -> Plus

IP08740.pep Sequence

Translation from 113 to 778

> IP08740.pep
MSGSPSMPRRRQIGHTSGHCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSD
CKENGVSNGLHSLDHPLQCLMDRDALELHFAGEPIPILCADSFTCPVCGE
MGFSVEDLRTHCQDNHRMARTVCICPVCAAVPLSQPSHIAHIANHLMFSP
SHRATGDPMIDISATSQAEGSSLPQNSAVSSGSGAQHTFSSSENSQVRFL
LPGNRAPLADSDDFNMDNWEV*

IP08740.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22458-PA 101 GF22458-PA 2..97 16..111 332 64.6 Plus
Dana\GF18435-PA 630 GF18435-PA 2..134 17..148 293 42.1 Plus
Dana\GF15414-PA 580 GF15414-PA 4..124 19..139 197 29.8 Plus
Dana\GF14892-PA 409 GF14892-PA 2..138 18..149 194 30.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18632-PA 317 GG18632-PA 75..310 2..215 649 55.9 Plus
Dere\GG17402-PA 642 GG17402-PA 2..132 17..146 285 43.3 Plus
Dere\GG25126-PA 347 GG25126-PA 2..132 18..147 180 33.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12473-PA 212 GH12473-PA 4..131 19..146 353 53.9 Plus
Dgri\GH12271-PA 196 GH12271-PA 1..115 32..146 316 53.9 Plus
Dgri\GH18223-PA 596 GH18223-PA 2..130 17..145 291 41.1 Plus
Dgri\GH10832-PA 378 GH10832-PA 2..134 18..149 214 33.8 Plus
Dgri\GH11341-PA 456 GH11341-PA 4..144 19..159 180 27.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG3526-PC 221 CG3526-PC 1..221 1..221 1219 100 Plus
CG3526-PA 229 CG3526-PA 9..229 1..221 1216 99.5 Plus
Kcmf1-PI 599 CG11984-PI 2..160 17..186 301 38 Plus
Kcmf1-PH 599 CG11984-PH 2..160 17..186 301 38 Plus
Kcmf1-PG 599 CG11984-PG 2..160 17..186 301 38 Plus
Kcmf1-PF 599 CG11984-PF 2..160 17..186 301 38 Plus
Kcmf1-PE 599 CG11984-PE 2..160 17..186 301 38 Plus
Kcmf1-PD 599 CG11984-PD 2..160 17..186 301 38 Plus
CG42585-PA 349 CG42585-PA 2..132 18..147 221 31.3 Plus
CG31835-PA 349 CG31835-PA 2..132 18..147 221 31.3 Plus
CG15286-PB 511 CG15286-PB 6..153 19..177 211 28.9 Plus
CG15286-PA 511 CG15286-PA 6..153 19..177 211 28.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11155-PA 325 GI11155-PA 4..179 19..180 395 46.6 Plus
Dmoj\GI10177-PA 599 GI10177-PA 2..134 17..148 299 42.9 Plus
Dmoj\GI17346-PA 415 GI17346-PA 2..139 18..149 201 31.9 Plus
Dmoj\GI12847-PA 522 GI12847-PA 4..108 19..124 178 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19931-PA 201 GL19931-PA 9..193 24..207 350 41.5 Plus
Dper\GL19795-PA 201 GL19795-PA 9..193 24..207 350 41.5 Plus
Dper\GL19926-PA 154 GL19926-PA 2..133 16..146 306 47.7 Plus
Dper\GL12494-PA 160 GL12494-PA 2..132 17..146 272 42.7 Plus
Dper\GL26000-PA 433 GL26000-PA 2..134 18..147 208 31.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17500-PA 199 GA17500-PA 9..191 24..207 350 40.3 Plus
Dpse\GA28470-PA 198 GA28470-PA 9..190 24..207 348 41.4 Plus
Dpse\GA28432-PA 154 GA28432-PA 2..133 16..146 307 48.5 Plus
Dpse\GA11311-PC 580 GA11311-PC 2..134 17..148 290 42.1 Plus
Dpse\GA16514-PA 433 GA16514-PA 2..134 18..147 212 33.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19251-PA 223 GM19251-PA 73..223 2..152 726 89.4 Plus
Dsec\GM26291-PA 644 GM26291-PA 2..134 17..148 292 42.1 Plus
Dsec\GM15732-PA 349 GM15732-PA 2..132 18..147 204 31.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24739-PA 146 GD24739-PA 1..146 7..152 703 89 Plus
Dsim\GD20827-PA 628 GD20827-PA 2..134 17..148 292 42.1 Plus
Dsim\GD23974-PA 349 GD23974-PA 2..132 18..147 212 32.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15286-PA 312 GJ15286-PA 4..131 19..146 381 53.9 Plus
Dvir\GJ10879-PA 608 GJ10879-PA 2..134 17..148 299 42.9 Plus
Dvir\GJ16109-PA 410 GJ16109-PA 2..138 18..149 223 34.3 Plus
Dvir\GJ18179-PA 498 GJ18179-PA 4..108 19..124 171 31.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25525-PA 285 GK25525-PA 2..152 17..172 390 47.4 Plus
Dwil\GK11423-PA 620 GK11423-PA 2..134 17..148 292 42.1 Plus
Dwil\GK18299-PA 435 GK18299-PA 2..136 18..149 225 32.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16285-PA 305 GE16285-PA 80..298 5..215 671 61.6 Plus
Dyak\GE24805-PA 645 GE24805-PA 2..134 17..148 293 42.1 Plus
Dyak\GE19043-PA 351 GE19043-PA 2..132 18..147 172 34.4 Plus

IP08740.hyp Sequence

Translation from 113 to 778

> IP08740.hyp
MSGSPSMPRRRQIGHTSGHCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSD
CKENGVSNGLHSLDHPLQCLMDRDALELHFAGEPIPILCADSFTCPVCGE
MGFSVEDLRTHCQDNHRMARTVCICPVCAAVPLSQPSHIAHIANHLMFSP
SHRATGDPMIDISATSQAEGSSLPQNSAVSSGSGAQHTFSSSENSQVRFL
LPGNRAPLADSDDFNMDNWEV*

IP08740.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG3526-PC 221 CG3526-PC 1..221 1..221 1219 100 Plus
CG3526-PA 229 CG3526-PA 9..229 1..221 1216 99.5 Plus
CG11984-PI 599 CG11984-PI 2..160 17..186 301 38 Plus
CG11984-PH 599 CG11984-PH 2..160 17..186 301 38 Plus
CG11984-PG 599 CG11984-PG 2..160 17..186 301 38 Plus