Clone IP08764 Report

Search the DGRC for IP08764

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:87
Well:64
Vector:pOT2
Associated Gene/TranscriptCpr92A-RA
Protein status:IP08764.pep: gold
Preliminary Size:711
Sequenced Size:1143

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6240 2005-01-01 Successful iPCR screen
Cpr92A 2008-04-29 Release 5.5 accounting
Cpr92A 2008-08-15 Release 5.9 accounting
Cpr92A 2008-12-18 5.12 accounting

Clone Sequence Records

IP08764.complete Sequence

1143 bp (1143 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023126

> IP08764.complete
CTTCTTCTAGCGCGATCGTCGTCGAAACCAACAATACTCCGGCCACTCTC
TACGTGTGGTGTCTGCTGAGTCTGTGACAACTGTGAGCGAGTGGAAAGGA
TACCCCTGCAAGGACATCGTTATGCTGAAGATTTCCCTGCTGAGCGCCAT
GCTCGGCATCGCCTATGCGGGCGTGATTGGACCCGGACCATACTATGGCG
GTCCAGCTGGTCCCGGACCTCTGCACCACTATGGAGGATATGCACCGCAG
CATGGGCCCCTGCCAGGTCCCTATGTGGCGCCCAAGCCGGCTGCTCCCGA
ACCCTACGATCCCGACCCGAAGTACTCCTTTGGCTACGACATCCAGGATG
GTTATACTGGTGACCTGAAGTCACAGCACGAGACGCGCCACGGAGATGTG
GTGAAGGGCAGCTACTCGGTTGTGGATCCGGATGGAACCAAACGCACCGT
TGACTACACAGCGGATCCCCATCACGGATTCAATGCGGTGGTCCGCAAGG
AGCCGCTGGCCTACAAGGCACCAGCCCACCTGGCACCCGTCGTCGCACCT
GCACCCGCTCCAGTACCAGCTCATTACGGCCCAGCTCCGGCGCCTCCACT
TCCGCCGGTGCCTAAGGCTCCTCTGCTTTCGTATCCTCTTGCCTTAGGAC
CTTACCACCGTGGTGCTCCCGCTCCTGCACCAGGTCCCGCTCCCGCTCCT
GCTCCAGCTCCGGTGTCTGTGCCAGTGGCTACTCCAGTCCTGCCCTCCGC
CCACTTCCATGCCGCCTATCCCGCCCTGGCGCACAGCCCCTATGCCCACT
ATCCGGCTCCAGGTCCGGCCCCCGCTCCAGTGGAACCCCATGCCTACTAC
CATCACTGAGGGACCAAGGTTCTCAACTATCTGATCTGATTTGATTCGAC
TTCATCTATCGCACGCAGCTTACACTGACCCAAAACTGAAACTCCGGCTA
TATCTGTGCCAAACGCTGTACTCTCAATCTCTTACTCTGTGTTCTTCGAG
GGATTTGATACCGATCCAACATGTAGATTGATTCTAAGTTACCCCTAGCC
TATGTACACGTCTTTAAGAAAATGTTGTTGAATGGTTAGTCTAGGAAATA
AAACGAGAATTGAAAAACCTAAAAAAAAAAAAAAAAAAAAAAA

IP08764.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr92A.a 1819 Cpr92A.a 690..1815 1..1126 5600 99.8 Plus
Cpr92A-RA 1359 Cpr92A-RA 156..1281 1..1126 5600 99.8 Plus
Cpr62Bb-RA 1037 Cpr62Bb-RA 325..451 366..492 230 78.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15421361..15422352 1120..129 4780 98.8 Minus
chr3R 27901430 chr3R 15422685..15422814 130..1 605 97.7 Minus
chr3L 24539361 chr3L 4207801..4207954 496..343 185 74.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:57:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19597496..19598493 1126..129 4960 99.8 Minus
3R 32079331 3R 19598826..19598955 130..1 650 100 Minus
3L 28110227 3L 4208415..4208568 496..343 185 74.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19338327..19339324 1126..129 4960 99.7 Minus
3R 31820162 3R 19339657..19339786 130..1 650 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:18:09 has no hits.

IP08764.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:19:18 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15421361..15421652 829..1120 98 == Minus
chr3R 15421821..15422350 131..660 98 <- Minus
chr3R 15422685..15422814 1..130 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:46 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr92A-RA 1..738 122..859 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:17:49 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr92A-RA 1..738 122..859 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:07:05 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr92A-RA 1..738 122..859 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:08 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr92A-RA 1..738 122..859 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:24:43 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr92A-RA 1..738 122..859 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:17:29 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr92A-RA 1..1114 7..1120 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:17:49 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr92A-RA 1..1114 7..1120 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:07:05 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr92A-RA 1..1120 1..1120 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:08 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr92A-RA 1..1114 7..1120 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:24:43 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr92A-RA 1..1120 1..1120 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:18 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19597502..19598491 131..1120 99 <- Minus
3R 19598826..19598955 1..130 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:18 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19597502..19598491 131..1120 99 <- Minus
3R 19598826..19598955 1..130 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:18 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19597502..19598491 131..1120 99 <- Minus
3R 19598826..19598955 1..130 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:07:05 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15423224..15424213 131..1120 99 <- Minus
arm_3R 15424548..15424677 1..130 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:37:56 Download gff for IP08764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19338333..19339322 131..1120 99 <- Minus
3R 19339657..19339786 1..130 100   Minus

IP08764.pep Sequence

Translation from 121 to 858

> IP08764.pep
MLKISLLSAMLGIAYAGVIGPGPYYGGPAGPGPLHHYGGYAPQHGPLPGP
YVAPKPAAPEPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSV
VDPDGTKRTVDYTADPHHGFNAVVRKEPLAYKAPAHLAPVVAPAPAPVPA
HYGPAPAPPLPPVPKAPLLSYPLALGPYHRGAPAPAPGPAPAPAPAPVSV
PVATPVLPSAHFHAAYPALAHSPYAHYPAPGPAPAPVEPHAYYHH*

IP08764.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18457-PA 246 GF18457-PA 1..246 1..245 721 88.6 Plus
Dana\GF23877-PA 204 GF23877-PA 60..197 55..209 277 49.7 Plus
Dana\GF17800-PA 223 GF17800-PA 6..149 4..160 272 45.3 Plus
Dana\GF21621-PA 486 GF21621-PA 63..194 56..194 271 36.7 Plus
Dana\GF21210-PA 141 GF21210-PA 26..136 24..148 261 48.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15930-PA 245 GG15930-PA 1..245 1..245 824 93.2 Plus
Dere\GG14209-PA 195 GG14209-PA 6..137 4..145 313 54.9 Plus
Dere\GG13610-PA 183 GG13610-PA 16..176 43..217 269 43.1 Plus
Dere\GG13621-PA 182 GG13621-PA 34..103 60..129 263 64.3 Plus
Dere\GG14206-PA 148 GG14206-PA 65..146 63..148 261 60.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22387-PA 235 GH22387-PA 1..235 1..245 604 69.5 Plus
Dgri\GH15546-PA 200 GH15546-PA 61..167 59..158 293 57.9 Plus
Dgri\GH18125-PA 182 GH18125-PA 18..153 45..193 288 44.3 Plus
Dgri\GH15545-PA 117 GH15545-PA 28..114 62..156 260 58.9 Plus
Dgri\GH18128-PA 166 GH18128-PA 57..128 58..129 260 63.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:37
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr92A-PA 245 CG6240-PA 1..245 1..245 1374 100 Plus
Cpr64Aa-PA 192 CG15006-PA 6..192 4..213 394 45.4 Plus
Ccp84Ag-PA 191 CG2342-PA 22..183 50..225 327 46.6 Plus
Ccp84Ad-PA 199 CG2341-PA 4..199 3..245 322 39.6 Plus
Ccp84Ab-PA 221 CG1252-PA 13..221 9..245 320 40 Plus
Ccp84Aa-PA 205 CG2360-PA 13..205 9..236 302 39.8 Plus
Ccp84Ac-PA 217 CG1327-PA 6..216 4..245 302 36.6 Plus
Ccp84Ae-PA 208 CG1330-PA 32..196 48..202 294 45.8 Plus
Edg84A-PA 188 CG2345-PA 16..181 43..217 290 45.6 Plus
Cpr62Bb-PC 194 CG13935-PC 22..152 55..196 283 46.9 Plus
Cpr62Bb-PB 194 CG13935-PB 22..152 55..196 283 46.9 Plus
Cpr62Bb-PA 194 CG13935-PA 22..152 55..196 283 46.9 Plus
Cpr62Bc-PB 180 CG1919-PB 11..178 9..199 282 42.1 Plus
Cpr62Bc-PA 180 CG1919-PA 11..178 9..199 282 42.1 Plus
Cpr5C-PA 145 CG4052-PA 4..143 3..152 280 46.1 Plus
Cpr64Ad-PB 247 CG1259-PB 117..244 41..156 280 50 Plus
CG34461-PB 138 CG34461-PB 16..133 29..145 278 52.1 Plus
CG34461-PA 138 CG34461-PA 16..133 29..145 278 52.1 Plus
Cpr64Ac-PA 188 CG15008-PA 12..188 6..179 268 39.6 Plus
Cpr31A-PA 340 CG33302-PA 120..228 53..161 265 53.6 Plus
Cpr64Ab-PA 120 CG15007-PA 37..118 63..148 264 60.5 Plus
Ccp84Af-PA 151 CG1331-PA 52..147 58..152 257 54.2 Plus
Cpr66Cb-PA 162 CG7076-PA 39..152 31..136 252 47.1 Plus
Cpr30F-PA 146 CG31876-PA 45..141 68..158 245 51.5 Plus
Crys-PB 477 CG16963-PB 65..138 56..129 230 56.8 Plus
Crys-PA 477 CG16963-PA 65..138 56..129 230 56.8 Plus
Cpr23B-PA 302 CG2973-PA 133..235 43..145 227 50 Plus
Cpr76Bb-PA 198 CG9290-PA 54..144 14..126 222 45.1 Plus
CG42367-PC 103 CG42367-PC 38..101 67..130 200 56.2 Plus
CG10953-PB 278 CG10953-PB 9..244 9..237 197 32 Plus
CG10953-PA 278 CG10953-PA 9..244 9..237 197 32 Plus
CG13670-PA 266 CG13670-PA 73..159 40..124 194 49.4 Plus
Cpr35B-PA 218 CG3474-PA 52..133 36..129 192 42.6 Plus
Cpr76Bd-PD 1228 CG9299-PD 1082..1209 2..124 192 41.7 Plus
Cpr76Bd-PB 1228 CG9299-PB 1082..1209 2..124 192 41.7 Plus
Cpr76Bd-PC 1231 CG9299-PC 1085..1212 2..124 192 41.7 Plus
Cpr76Bc-PD 424 CG9295-PD 49..113 61..125 190 55.4 Plus
Cpr76Bc-PC 424 CG9295-PC 49..113 61..125 190 55.4 Plus
Cpr30B-PA 153 CG3818-PA 33..125 68..171 187 39.4 Plus
CG31626-PB 285 CG31626-PB 59..277 21..244 185 33.2 Plus
CG31626-PA 285 CG31626-PA 59..277 21..244 185 33.2 Plus
Cpr76Ba-PA 204 CG9283-PA 98..157 66..125 183 55 Plus
CG2962-PA 376 CG2962-PA 95..347 1..240 179 29.5 Plus
Cpr66D-PA 270 CG32029-PA 153..230 63..149 178 43.7 Plus
Cpr92F-PA 381 CG5494-PA 40..230 77..245 172 34.7 Plus
CG10953-PB 278 CG10953-PB 25..131 131..238 171 43.8 Plus
CG10953-PA 278 CG10953-PA 25..131 131..238 171 43.8 Plus
CG32248-PB 182 CG32248-PB 22..128 131..241 162 41.2 Plus
Muc91C-PB 949 CG7709-PB 243..461 21..236 161 29.8 Plus
Muc91C-PA 950 CG7709-PA 244..462 21..236 161 29.8 Plus
CG30457-PA 189 CG30457-PA 38..148 128..238 160 37 Plus
CG32564-PA 409 CG32564-PA 27..294 3..234 159 31.1 Plus
CG15740-PB 975 CG15740-PB 591..709 128..237 159 38.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24469-PA 217 GI24469-PA 1..217 1..245 480 65.1 Plus
Dmoj\GI16821-PA 193 GI16821-PA 58..148 55..145 286 64.8 Plus
Dmoj\GI14580-PA 193 GI14580-PA 58..148 55..145 286 64.8 Plus
Dmoj\GI23757-PA 176 GI23757-PA 56..173 58..157 268 54.2 Plus
Dmoj\GI23842-PA 176 GI23842-PA 56..173 58..157 268 54.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12729-PA 184 GL12729-PA 27..184 52..213 293 48.5 Plus
Dper\GL22049-PA 231 GL22049-PA 6..159 4..161 259 40.7 Plus
Dper\GL21769-PA 198 GL21769-PA 34..103 60..129 258 62.9 Plus
Dper\GL21768-PA 178 GL21768-PA 27..99 58..130 253 57.5 Plus
Dper\GL19198-PA 146 GL19198-PA 47..142 68..168 250 50.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19466-PA 240 GA19466-PA 1..240 1..245 428 61.6 Plus
Dpse\GA28205-PA 215 GA28205-PA 61..215 55..213 294 50 Plus
Dpse\GA15354-PA 198 GA15354-PA 34..103 60..129 259 62.9 Plus
Dpse\GA12160-PA 231 GA12160-PA 6..159 4..161 258 40.7 Plus
Dpse\GA15355-PA 178 GA15355-PA 16..99 43..130 254 53.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26903-PA 245 GM26903-PA 1..245 1..245 1139 98.8 Plus
Dsec\GM13999-PA 195 GM13999-PA 47..137 55..145 297 64.8 Plus
Dsec\GM10909-PA 188 GM10909-PA 16..181 43..217 280 44.8 Plus
Dsec\GM12439-PA 145 GM12439-PA 54..136 58..140 262 59 Plus
Dsec\GM13998-PA 147 GM13998-PA 64..145 63..148 260 60.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20110-PA 211 GD20110-PA 1..211 1..245 897 84.1 Plus
Dsim\GD13280-PA 195 GD13280-PA 47..137 55..145 297 64.8 Plus
Dsim\GD19888-PA 188 GD19888-PA 22..181 53..217 273 43.3 Plus
Dsim\GD16755-PA 145 GD16755-PA 54..136 58..140 265 60.2 Plus
Dsim\GD17606-PA 192 GD17606-PA 22..135 55..169 264 51.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24536-PA 245 GJ24536-PA 11..225 3..224 511 70.9 Plus
Dvir\GJ12567-PA 247 GJ12567-PA 108..243 59..193 301 57.4 Plus
Dvir\GJ23301-PA 175 GJ23301-PA 56..145 58..148 265 62 Plus
Dvir\GJ23298-PA 181 GJ23298-PA 24..131 54..171 261 47.9 Plus
Dvir\GJ23942-PA 183 GJ23942-PA 36..161 55..198 260 44.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13476-PA 245 GK13476-PA 14..245 4..245 541 69.4 Plus
Dwil\GK10248-PA 206 GK10248-PA 62..153 55..146 297 65.2 Plus
Dwil\GK12249-PA 228 GK12249-PA 45..171 58..191 259 48.2 Plus
Dwil\GK10832-PA 179 GK10832-PA 45..141 58..163 258 53.3 Plus
Dwil\GK12247-PA 194 GK12247-PA 34..103 60..129 255 61.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25123-PA 498 GE25123-PA 254..498 1..245 1142 98 Plus
Dyak\GE25123-PA 498 GE25123-PA 1..210 1..212 964 95.8 Plus
Dyak\GE20636-PA 195 GE20636-PA 6..119 4..127 312 53.2 Plus
Dyak\GE24878-PA 188 GE24878-PA 27..151 58..199 264 45.8 Plus
Dyak\GE20635-PA 120 GE20635-PA 37..118 63..148 262 60.5 Plus
Dyak\GE24879-PA 191 GE24879-PA 34..103 60..129 261 62.9 Plus

IP08764.hyp Sequence

Translation from 121 to 858

> IP08764.hyp
MLKISLLSAMLGIAYAGVIGPGPYYGGPAGPGPLHHYGGYAPQHGPLPGP
YVAPKPAAPEPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSV
VDPDGTKRTVDYTADPHHGFNAVVRKEPLAYKAPAHLAPVVAPAPAPVPA
HYGPAPAPPLPPVPKAPLLSYPLALGPYHRGAPAPAPGPAPAPAPAPVSV
PVATPVLPSAHFHAAYPALAHSPYAHYPAPGPAPAPVEPHAYYHH*

IP08764.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr92A-PA 245 CG6240-PA 1..245 1..245 1374 100 Plus
Cpr64Aa-PA 192 CG15006-PA 6..192 4..213 394 45.4 Plus
Ccp84Ag-PA 191 CG2342-PA 22..183 50..225 327 46.6 Plus
Ccp84Ad-PA 199 CG2341-PA 4..199 3..245 322 39.6 Plus
Ccp84Ab-PA 221 CG1252-PA 13..221 9..245 320 40 Plus