Clone IP08767 Report

Search the DGRC for IP08767

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:87
Well:67
Vector:pOT2
Associated Gene/Transcriptcona-RA
Protein status:IP08767.pep: gold
Preliminary Size:661
Sequenced Size:827

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7676 2005-01-01 Successful iPCR screen
cona 2008-04-29 Release 5.5 accounting
cona 2008-08-15 Release 5.9 accounting
cona 2008-12-18 5.12 accounting

Clone Sequence Records

IP08767.complete Sequence

827 bp (827 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023130

> IP08767.complete
ATTATTATTACAGTTAAACAAATTGTTATCCAAAACTACATGAGCAATGG
GTAGTAACCAAGATTGGAACAAGGAAGACTCCAAAACTGAGGTCCCACCT
GAGGAAGATGACCAAGTGACAGCATACATTGAGAAATCAGTGGCCCAATT
GGGCTCCGAAAATGATCACCGTACCGCGCTGGTCGATGAAAAGAAGAAGG
AGTTGGATGTCCTGATTGCCGAGAAGTACACCACTTTGAACGACTTAACC
CATGTCACCAATTCCCAGAATCTTGTGGACGACATCCACTTTCTGCATAC
GAAGAACGCCAAGATCCTGGAGAGCCTCAATCAGGCGGTCACCGCCAAGA
GAAACGTCTCCCAGGCCTACGATGACCATTGCAAGAAGGCGCTCAAGGTC
AAGGCCGAGATGCAGGAGCAGACGAAATGCTTCGATGAGTTCACCGTGAT
GAACTACCACGATCTAAAGAAGACCATACTTAACACCAAGAAAGAAACGC
AAGAAATTCGCGCTAAGACGGCTTTAAAGACCGAGGAGCTCAAAAAGAAG
CGAGAATTTGTTAACACCACCCAAAAGTCAATGGCTAATGATATCCGTGT
TCTAGGCCAGATCGAACATGACCTCATTGGGATAATCGAAGACTTAAAAT
CCAAAATTTCTGCAATTTAAGTACAGGAAAACAAATAACACTTGAACAAT
CGCCAAAGGTGCATTGGAAAATACGGTCGTACCTCATCTTCCAAAAAATA
ATCCTTAATATTGCTGCGTTTTCCAAATAATTTGACAAATAAAGTACTTT
TTATTCTGTAAAAAAAAAAAAAAAAAA

IP08767.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
cona-RA 890 cona-RA 80..890 1..811 4055 100 Plus
CG7678-RA 2817 CG7678-RA 2761..2817 811..755 285 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14210276..14210576 151..451 1460 99 Plus
chr3R 27901430 chr3R 14210648..14210824 451..627 870 99.4 Plus
chr3R 27901430 chr3R 14210896..14211077 628..809 790 95.6 Plus
chr3R 27901430 chr3R 14210066..14210217 1..152 760 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:57:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18386086..18386386 151..451 1505 100 Plus
3R 32079331 3R 18386706..18386889 628..811 920 100 Plus
3R 32079331 3R 18386458..18386634 451..627 885 100 Plus
3R 32079331 3R 18385876..18386027 1..152 760 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18126917..18127217 151..451 1505 100 Plus
3R 31820162 3R 18127537..18127720 628..811 920 100 Plus
3R 31820162 3R 18127289..18127465 451..627 885 100 Plus
3R 31820162 3R 18126707..18126858 1..152 760 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:57:05 has no hits.

IP08767.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:58:00 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14210066..14210216 1..151 100 -> Plus
chr3R 14210277..14210576 152..451 99 -> Plus
chr3R 14210649..14210813 452..616 99 == Plus
chr3R 14210905..14211077 637..809 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:47 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
cona-RA 1..624 47..670 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:17:50 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
cona-RA 1..624 47..670 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:35 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
cona-RA 1..624 47..670 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:09 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
cona-RA 1..624 47..670 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:26:18 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
cona-RA 1..624 47..670 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:17:31 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
cona-RA 49..857 1..809 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:17:50 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
cona-RA 49..857 1..809 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:35 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
cona-RA 49..857 1..809 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:09 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
cona-RA 49..857 1..809 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:26:18 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
cona-RA 49..857 1..809 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:00 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18385876..18386026 1..151 100 -> Plus
3R 18386087..18386386 152..451 100 -> Plus
3R 18386459..18386634 452..627 100 -> Plus
3R 18386706..18386887 628..809 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:00 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18385876..18386026 1..151 100 -> Plus
3R 18386087..18386386 152..451 100 -> Plus
3R 18386459..18386634 452..627 100 -> Plus
3R 18386706..18386887 628..809 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:00 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18385876..18386026 1..151 100 -> Plus
3R 18386087..18386386 152..451 100 -> Plus
3R 18386459..18386634 452..627 100 -> Plus
3R 18386706..18386887 628..809 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:35 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14211598..14211748 1..151 100 -> Plus
arm_3R 14211809..14212108 152..451 100 -> Plus
arm_3R 14212181..14212356 452..627 100 -> Plus
arm_3R 14212428..14212609 628..809 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:37:57 Download gff for IP08767.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18126918..18127217 152..451 100 -> Plus
3R 18127290..18127465 452..627 100 -> Plus
3R 18127537..18127718 628..809 100   Plus
3R 18126707..18126857 1..151 100 -> Plus

IP08767.pep Sequence

Translation from 46 to 669

> IP08767.pep
MGSNQDWNKEDSKTEVPPEEDDQVTAYIEKSVAQLGSENDHRTALVDEKK
KELDVLIAEKYTTLNDLTHVTNSQNLVDDIHFLHTKNAKILESLNQAVTA
KRNVSQAYDDHCKKALKVKAEMQEQTKCFDEFTVMNYHDLKKTILNTKKE
TQEIRAKTALKTEELKKKREFVNTTQKSMANDIRVLGQIEHDLIGIIEDL
KSKISAI*

IP08767.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22880-PA 199 GG22880-PA 1..197 1..192 608 62.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
cona-PA 207 CG7676-PA 1..207 1..207 1052 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26847-PA 201 GA26847-PA 12..196 6..189 143 29.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17867-PA 194 GM17867-PA 1..194 1..194 889 88.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19229-PA 194 GD19229-PA 1..194 1..194 894 88.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25535-PA 194 GE25535-PA 1..192 1..192 629 63.5 Plus
Dyak\GE14694-PA 190 GE14694-PA 1..188 1..192 600 62.5 Plus

IP08767.hyp Sequence

Translation from 46 to 669

> IP08767.hyp
MGSNQDWNKEDSKTEVPPEEDDQVTAYIEKSVAQLGSENDHRTALVDEKK
KELDVLIAEKYTTLNDLTHVTNSQNLVDDIHFLHTKNAKILESLNQAVTA
KRNVSQAYDDHCKKALKVKAEMQEQTKCFDEFTVMNYHDLKKTILNTKKE
TQEIRAKTALKTEELKKKREFVNTTQKSMANDIRVLGQIEHDLIGIIEDL
KSKISAI*

IP08767.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
cona-PA 207 CG7676-PA 1..207 1..207 1052 100 Plus