IP08767.complete Sequence
827 bp (827 high quality bases) assembled on 2005-03-06
GenBank Submission: BT023130
> IP08767.complete
ATTATTATTACAGTTAAACAAATTGTTATCCAAAACTACATGAGCAATGG
GTAGTAACCAAGATTGGAACAAGGAAGACTCCAAAACTGAGGTCCCACCT
GAGGAAGATGACCAAGTGACAGCATACATTGAGAAATCAGTGGCCCAATT
GGGCTCCGAAAATGATCACCGTACCGCGCTGGTCGATGAAAAGAAGAAGG
AGTTGGATGTCCTGATTGCCGAGAAGTACACCACTTTGAACGACTTAACC
CATGTCACCAATTCCCAGAATCTTGTGGACGACATCCACTTTCTGCATAC
GAAGAACGCCAAGATCCTGGAGAGCCTCAATCAGGCGGTCACCGCCAAGA
GAAACGTCTCCCAGGCCTACGATGACCATTGCAAGAAGGCGCTCAAGGTC
AAGGCCGAGATGCAGGAGCAGACGAAATGCTTCGATGAGTTCACCGTGAT
GAACTACCACGATCTAAAGAAGACCATACTTAACACCAAGAAAGAAACGC
AAGAAATTCGCGCTAAGACGGCTTTAAAGACCGAGGAGCTCAAAAAGAAG
CGAGAATTTGTTAACACCACCCAAAAGTCAATGGCTAATGATATCCGTGT
TCTAGGCCAGATCGAACATGACCTCATTGGGATAATCGAAGACTTAAAAT
CCAAAATTTCTGCAATTTAAGTACAGGAAAACAAATAACACTTGAACAAT
CGCCAAAGGTGCATTGGAAAATACGGTCGTACCTCATCTTCCAAAAAATA
ATCCTTAATATTGCTGCGTTTTCCAAATAATTTGACAAATAAAGTACTTT
TTATTCTGTAAAAAAAAAAAAAAAAAA
IP08767.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:47:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cona-RA | 890 | cona-RA | 80..890 | 1..811 | 4055 | 100 | Plus |
CG7678-RA | 2817 | CG7678-RA | 2761..2817 | 811..755 | 285 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:57:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 14210276..14210576 | 151..451 | 1460 | 99 | Plus |
chr3R | 27901430 | chr3R | 14210648..14210824 | 451..627 | 870 | 99.4 | Plus |
chr3R | 27901430 | chr3R | 14210896..14211077 | 628..809 | 790 | 95.6 | Plus |
chr3R | 27901430 | chr3R | 14210066..14210217 | 1..152 | 760 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:57:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18386086..18386386 | 151..451 | 1505 | 100 | Plus |
3R | 32079331 | 3R | 18386706..18386889 | 628..811 | 920 | 100 | Plus |
3R | 32079331 | 3R | 18386458..18386634 | 451..627 | 885 | 100 | Plus |
3R | 32079331 | 3R | 18385876..18386027 | 1..152 | 760 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 18126917..18127217 | 151..451 | 1505 | 100 | Plus |
3R | 31820162 | 3R | 18127537..18127720 | 628..811 | 920 | 100 | Plus |
3R | 31820162 | 3R | 18127289..18127465 | 451..627 | 885 | 100 | Plus |
3R | 31820162 | 3R | 18126707..18126858 | 1..152 | 760 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 02:57:05 has no hits.
IP08767.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:58:00 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 14210066..14210216 | 1..151 | 100 | -> | Plus |
chr3R | 14210277..14210576 | 152..451 | 99 | -> | Plus |
chr3R | 14210649..14210813 | 452..616 | 99 | == | Plus |
chr3R | 14210905..14211077 | 637..809 | 95 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:37:47 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cona-RA | 1..624 | 47..670 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:17:50 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cona-RA | 1..624 | 47..670 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:35 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cona-RA | 1..624 | 47..670 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:09 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cona-RA | 1..624 | 47..670 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:26:18 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cona-RA | 1..624 | 47..670 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:17:31 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cona-RA | 49..857 | 1..809 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:17:50 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cona-RA | 49..857 | 1..809 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:35 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cona-RA | 49..857 | 1..809 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:09 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cona-RA | 49..857 | 1..809 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:26:18 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cona-RA | 49..857 | 1..809 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:00 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18385876..18386026 | 1..151 | 100 | -> | Plus |
3R | 18386087..18386386 | 152..451 | 100 | -> | Plus |
3R | 18386459..18386634 | 452..627 | 100 | -> | Plus |
3R | 18386706..18386887 | 628..809 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:00 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18385876..18386026 | 1..151 | 100 | -> | Plus |
3R | 18386087..18386386 | 152..451 | 100 | -> | Plus |
3R | 18386459..18386634 | 452..627 | 100 | -> | Plus |
3R | 18386706..18386887 | 628..809 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:00 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18385876..18386026 | 1..151 | 100 | -> | Plus |
3R | 18386087..18386386 | 152..451 | 100 | -> | Plus |
3R | 18386459..18386634 | 452..627 | 100 | -> | Plus |
3R | 18386706..18386887 | 628..809 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:35 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14211598..14211748 | 1..151 | 100 | -> | Plus |
arm_3R | 14211809..14212108 | 152..451 | 100 | -> | Plus |
arm_3R | 14212181..14212356 | 452..627 | 100 | -> | Plus |
arm_3R | 14212428..14212609 | 628..809 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:37:57 Download gff for
IP08767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18126918..18127217 | 152..451 | 100 | -> | Plus |
3R | 18127290..18127465 | 452..627 | 100 | -> | Plus |
3R | 18127537..18127718 | 628..809 | 100 | | Plus |
3R | 18126707..18126857 | 1..151 | 100 | -> | Plus |
IP08767.pep Sequence
Translation from 46 to 669
> IP08767.pep
MGSNQDWNKEDSKTEVPPEEDDQVTAYIEKSVAQLGSENDHRTALVDEKK
KELDVLIAEKYTTLNDLTHVTNSQNLVDDIHFLHTKNAKILESLNQAVTA
KRNVSQAYDDHCKKALKVKAEMQEQTKCFDEFTVMNYHDLKKTILNTKKE
TQEIRAKTALKTEELKKKREFVNTTQKSMANDIRVLGQIEHDLIGIIEDL
KSKISAI*
IP08767.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:26:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22880-PA | 199 | GG22880-PA | 1..197 | 1..192 | 608 | 62.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cona-PA | 207 | CG7676-PA | 1..207 | 1..207 | 1052 | 100 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:26:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA26847-PA | 201 | GA26847-PA | 12..196 | 6..189 | 143 | 29.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:26:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17867-PA | 194 | GM17867-PA | 1..194 | 1..194 | 889 | 88.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:26:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19229-PA | 194 | GD19229-PA | 1..194 | 1..194 | 894 | 88.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:26:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25535-PA | 194 | GE25535-PA | 1..192 | 1..192 | 629 | 63.5 | Plus |
Dyak\GE14694-PA | 190 | GE14694-PA | 1..188 | 1..192 | 600 | 62.5 | Plus |
IP08767.hyp Sequence
Translation from 46 to 669
> IP08767.hyp
MGSNQDWNKEDSKTEVPPEEDDQVTAYIEKSVAQLGSENDHRTALVDEKK
KELDVLIAEKYTTLNDLTHVTNSQNLVDDIHFLHTKNAKILESLNQAVTA
KRNVSQAYDDHCKKALKVKAEMQEQTKCFDEFTVMNYHDLKKTILNTKKE
TQEIRAKTALKTEELKKKREFVNTTQKSMANDIRVLGQIEHDLIGIIEDL
KSKISAI*
IP08767.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:56:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cona-PA | 207 | CG7676-PA | 1..207 | 1..207 | 1052 | 100 | Plus |